-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ULK3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 373-472 of human ULK3 (Q6PHR2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against ULK3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 373-472 of human ULK3 (Q6PHR2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-14324A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ULK3 |
| Form | Liquid | Species Reactivity | Human, Mouse, Rat |
| Isotype | IgG | Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. |
| Purification Method | Affinity purification | Positive Samples | 293T |
| Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 373-472 of human ULK3 (Q6PHR2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KPRLLAALEVASAAMAKEEAAGGEQDALDLYQHSLGELLLLLAAEPPGRRRELLHTEVQNLMARAEYLKEQVKMRESRWEADTLDKEGLSESVRSSCTLQ | Uniprot ID | Q6PHR2 |
Uniprot Id
Q6PHR2
Target Species
Human
Target Name
ULK3
Target Full Name
Serine/threonine-protein kinase ULK3
Target Function
Serine/threonine protein kinase that acts as a regulator of Sonic hedgehog (SHH) signaling and autophagy. Acts as a negative regulator of SHH signaling in the absence of SHH ligand: interacts with SUFU, thereby inactivating the protein kinase activity and preventing phosphorylation of GLI proteins (GLI1, GLI2 and/or GLI3). Positively regulates SHH signaling in the presence of SHH: dissociates from SUFU, autophosphorylates and mediates phosphorylation of GLI2, activating it and promoting its nuclear translocation. Phosphorylates in vitro GLI2, as well as GLI1 and GLI3, although less efficiently. Also acts as a regulator of autophagy: following cellular senescence, able to induce autophagy.
Target Subcellular Location
Cytoplasm. Note=Localizes to pre-autophagosomal structure during cellular senescence.
Target Protein Families
Protein kinase superfamily, Ser/Thr protein kinase family, APG1/unc-51/ULK1 subfamily
Target Tissue Specificity
Widely expressed. Highest levels observed in fetal brain. In adult tissues, high levels in brain, liver and kidney, moderate levels in testis and adrenal gland and low levels in heart, lung, stomach, thymus, prostate and placenta. In the brain, highest ex
Target Synonyms
DKFZP434C131; FLJ90566; Serine/threonine-protein kinase ULK3; Ulk3; ULK3_HUMAN; unc 51 like kinase 3 (C. elegans); Unc-51-like kinase 3
Target Background
Enables protein serine/threonine kinase activity. Involved in several processes, including fibroblast activation; protein autophosphorylation; and regulation of smoothened signaling pathway. Located in cytoplasm.
Notification