-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against UNG was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human UNG (NP_550433.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against UNG was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human UNG (NP_550433.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-03471A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | UNG |
| Target Synonyms | DGU; UDG; UNG1; UNG2; HIGM4; HIGM5; UNG15; UNG | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Mouse skeletal muscle, Rat skeletal muscle | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human UNG (NP_550433.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MIGQKTLYSFFSPSPARKRHAPSPEPAVQGTGVAGVPEESGDAAAIPAKKAPAGQEEPGTPPSSPLSAEQLDRIQRNKAAALLRLAARNVPVGFGESWKK | Uniprot ID | P13051 |
Uniprot Id
P13051
Target Species
Human
Target Name
UNG
Target Full Name
Uracil-DNA glycosylase
Target Function
Excises uracil residues from the DNA which can arise as a result of misincorporation of dUMP residues by DNA polymerase or due to deamination of cytosine.
Target Involvement
Immunodeficiency with hyper-IgM 5 (HIGM5)
Target Subcellular Location
[Isoform 1]: Mitochondrion.; [Isoform 2]: Nucleus.
Target Protein Families
Uracil-DNA glycosylase (UDG) superfamily, UNG family
Target Tissue Specificity
Isoform 1 is widely expressed with the highest expression in skeletal muscle, heart and testicles. Isoform 2 has the highest expression levels in tissues containing proliferating cells.
Target Synonyms
DGU; DKFZp781L1143; HIGM 4; HIGM4; OTTHUMP00000240527; OTTHUMP00000240528; OTTHUMP00000240529; UDG; UNG 1; UNG 15; ung; UNG_HUMAN; UNG1; UNG15; UNG2; Uracil DNA glycosylase 1; Uracil DNA glycosylase 2; Uracil DNA glycosylase; Uracil-DNA glycosylase
Target Background
This gene encodes one of several uracil-DNA glycosylases. One important function of uracil-DNA glycosylases is to prevent mutagenesis by eliminating uracil from DNA molecules by cleaving the N-glycosylic bond and initiating the base-excision repair (BER) pathway. Uracil bases occur from cytosine deamination or misincorporation of dUMP residues. Alternative promoter usage and splicing of this gene leads to two different isoforms: the mitochondrial UNG1 and the nuclear UNG2. The UNG2 term was used as a previous symbol for the CCNO gene (GeneID 10309), which has been confused with this gene, in the literature and some databases.
Notification