-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against USP10 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human USP10 (Q14694) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against USP10 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human USP10 (Q14694) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-16078A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | USP10 |
| Target Synonyms | UBPO; UBP10; MGC2621; USP10 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human USP10 (Q14694). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MALHSPQYIFGDFSPDEFNQFFVTPRSSVELPPYSGTVLCGTQAVDKLPDGQEYQRIEFGVDEVIEPSDTLPRTPSYSISSTLNPQAPEFILGCTASKIT | Uniprot ID | Q14694 |
Uniprot Id
Q14694
Target Species
Human
Target Name
USP10
Target Full Name
Ubiquitin carboxyl-terminal hydrolase 10
Target Function
Hydrolase that can remove conjugated ubiquitin from target proteins such as p53/TP53, BECN1, SNX3 and CFTR. Acts as an essential regulator of p53/TP53 stability: in unstressed cells, specifically deubiquitinates p53/TP53 in the cytoplasm, leading to counteract MDM2 action and stabilize p53/TP53. Following DNA damage, translocates to the nucleus and deubiquitinates p53/TP53, leading to regulate the p53/TP53-dependent DNA damage response. Component of a regulatory loop that controls autophagy and p53/TP53 levels: mediates deubiquitination of BECN1, a key regulator of autophagy, leading to stabilize the PIK3C3/VPS34-containing complexes. In turn, PIK3C3/VPS34-containing complexes regulate USP10 stability, suggesting the existence of a regulatory system by which PIK3C3/VPS34-containing complexes regulate p53/TP53 protein levels via USP10 and USP13. Does not deubiquitinate MDM2. Deubiquitinates CFTR in early endosomes, enhancing its endocytic recycling. Involved in a TANK-dependent negative feedback response to attenuate NF-kappaB activation via deubiquitinating IKBKG or TRAF6 in response to interleukin-1-beta (IL1B) stimulation or upon DNA damage. Deubiquitinates TBX21 leading to its stabilization.
Target Subcellular Location
Cytoplasm. Nucleus. Early endosome.
Target Protein Families
Peptidase C19 family, USP10 subfamily
Target Tissue Specificity
Widely expressed.
Target Synonyms
Deubiquitinating enzyme 10; KIAA0190; MGC124997; MGC2621; Ubiquitin carboxyl terminal hydrolase 10; Ubiquitin carboxyl-terminal hydrolase 10; Ubiquitin specific peptidase 10; Ubiquitin specific processing protease 10; Ubiquitin specific protease 10; Ubiquitin thioesterase 10; Ubiquitin thiolesterase 10; Ubiquitin-specific-processing protease 10; UBP10_HUMAN; UBPO; USP 10; USP10
Target Background
Ubiquitin is a highly conserved protein that is covalently linked to other proteins to regulate their function and degradation. This gene encodes a member of the ubiquitin-specific protease family of cysteine proteases. The enzyme specifically cleaves ubiquitin from ubiquitin-conjugated protein substrates. The protein is found in the nucleus and cytoplasm. It functions as a co-factor of the DNA-bound androgen receptor complex, and is inhibited by a protein in the Ras-GTPase pathway. The human genome contains several pseudogenes similar to this gene. Several transcript variants, some protein-coding and others not protein-coding, have been found for this gene.
Notification