Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against USP12 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human USP12 (NP_872294.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against USP12 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human USP12 (NP_872294.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-11969A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | USP12 |
| Target Synonyms | UBH1; USP12L1; USP12 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-375, A-549, Mouse brain | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human USP12 (NP_872294.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MEILMTVSKFASICTMGANASALEKEIGPEQFPVNEHYFGLVNFGNTCYCNSVLQALYFCRPFREKVLAYKSQPRKKESLLTCLADLFHSIATQKKKVGV | Uniprot ID | O75317 |
Uniprot Id
O75317
Target Species
Human
Target Name
USP12
Target Full Name
Ubiquitin carboxyl-terminal hydrolase 12
Target Function
Deubiquitinating enzyme. Has almost no deubiquitinating activity by itself and requires the interaction with WDR20 and WDR48 to have a high activity. Not involved in deubiquitination of monoubiquitinated FANCD2. In complex with WDR48, acts as a potential tumor suppressor by positively regulating PHLPP1 stability.
Target Protein Families
Peptidase C19 family, USP12/USP46 subfamily
Target Synonyms
Deubiquitinating enzyme 12; OTTHUMP00000042337; UBH 1; UBH1; Ubiquitin carboxyl terminal hydrolase 12; Ubiquitin carboxyl-terminal hydrolase 12; Ubiquitin hydrolyzing enzyme 1; Ubiquitin specific peptidase 12; Ubiquitin specific processing protease 12; Ubiquitin specific protease 12 like 1; Ubiquitin thioesterase 12; Ubiquitin thiolesterase 12; Ubiquitin-hydrolyzing enzyme 1; Ubiquitin-specific-processing protease 12; UBP12_HUMAN; USP 12; Usp12; USP12L1
Target Background
Enables cysteine-type endopeptidase activity and thiol-dependent deubiquitinase. Involved in protein deubiquitination. Predicted to be located in nucleoplasm. Predicted to be active in cytosol and nucleus.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
