Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against UTS2R was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 280-389 of human UTS2R (NP_061822.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against UTS2R was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 280-389 of human UTS2R (NP_061822.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04225A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | UTS2R |
| Target Synonyms | UTR; UTR2; GPR14; UR-2-R; UTS2R | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse heart, Rat brain, Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 280-389 of human UTS2R (NP_061822.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LAQYHQAPLAPRTARIVNYLTTCLTYGNSCANPFLYTLLTRNYRDHLRGRVRGPGSGGGRGPVPSLQPRARFQRCSGRSLSSCSPQPTDSLVLAPAAPARPAPEGPRAPA | Uniprot ID | Q9UKP6 |
Uniprot Id
Q9UKP6
Target Species
Human
Target Name
UTS2R
Target Full Name
Urotensin-2 receptor
Target Function
High affinity receptor for urotensin-2 and urotensin-2B. The activity of this receptor is mediated by a G-protein that activate a phosphatidylinositol-calcium second messenger system.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 1 family
Target Tissue Specificity
Most abundant expression in the heart and pancreas.
Target Synonyms
UTS2R; GPR14; Urotensin-2 receptor; UR-2-R; G-protein coupled receptor 14; Urotensin II receptor; UR-II-R
Target Background
Predicted to enable urotensin II receptor activity. Predicted to be involved in neuropeptide signaling pathway. Predicted to be located in plasma membrane. Predicted to be integral component of plasma membrane.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
