-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against VDR was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human VDR (NP_000367.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against VDR was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human VDR (NP_000367.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-02047A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | VDR |
| Target Synonyms | NR1I1; PPP1R163; VDR | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | NIH/3T3, Rat testis | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human VDR (NP_000367.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MEAMAASTSLPDPGDFDRNVPRICGVCGDRATGFHFNAMTCEGCKGFFRRSMKRKALFTCPFNGDCRITKDNRRHCQACRLKRCVDIGMMKEFILTDEEV | Uniprot ID | P11473 |
Uniprot Id
P11473
Target Species
Human
Target Name
VDR
Target Full Name
Vitamin D3 receptor
Target Function
Nuclear receptor for calcitriol, the active form of vitamin D3 which mediates the action of this vitamin on cells. Enters the nucleus upon vitamin D3 binding where it forms heterodimers with the retinoid X receptor/RXR. The VDR-RXR heterodimers bind to specific response elements on DNA and activate the transcription of vitamin D3-responsive target genes. Plays a central role in calcium homeostasis.
Target Involvement
Rickets vitamin D-dependent 2A (VDDR2A)
Target Subcellular Location
Nucleus. Cytoplasm.
Target Protein Families
Nuclear hormone receptor family, NR1 subfamily
Target Synonyms
1 25 dihydroxyvitamin D3 receptor; 1; 1,25 dihydroxyvitamin D3 receptor; 1,25-@dihydroxyvitamin D3 receptor; 25-dihydroxyvitamin D3 receptor; Member 1; NR1I1; Nuclear receptor subfamily 1 group I member 1; PPP1R163; Protein phosphatase 1, regulatory subunit 163; VDR; VDR_HUMAN; Vitamin D (1,25- dihydroxyvitamin D3) receptor; Vitamin D hormone receptor; Vitamin D nuclear receptor variant 1; Vitamin D receptor; Vitamin D3 receptor
Target Background
This gene encodes vitamin D3 receptor, which is a member of the nuclear hormone receptor superfamily of ligand-inducible transcription factors. This receptor also functions as a receptor for the secondary bile acid, lithocholic acid. Downstream targets of vitamin D3 receptor are principally involved in mineral metabolism, though this receptor regulates a variety of other metabolic pathways, such as those involved in immune response and cancer. Mutations in this gene are associated with type II vitamin D-resistant rickets. A single nucleotide polymorphism in the initiation codon results in an alternate translation start site three codons downstream. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. A recent study provided evidence for translational readthrough in this gene, and expression of an additional C-terminally extended isoform via the use of an alternative in-frame translation termination codon.
Notification