-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against VEGFC was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human VEGFC (NP_005420.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against VEGFC was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human VEGFC (NP_005420.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-12464A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | VEGFC |
| Target Synonyms | VRP; Flt4-L; LMPH1D; LMPHM4; VEGFC | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | U-251MG | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human VEGFC (NP_005420.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TISFANHTSCRCMSKLDVYRQVHSIIRRSLPATLPQCQAANKTCPTNYMWNNHICRCLAQEDFMFSSDAGDDSTDGFHDICGPNKELDEETCQCVCRAGLR | Uniprot ID | P49767 |
Uniprot Id
P49767
Target Species
Human
Target Name
VEGFC
Target Full Name
Vascular endothelial growth factor C
Target Function
Growth factor active in angiogenesis, and endothelial cell growth, stimulating their proliferation and migration and also has effects on the permeability of blood vessels. May function in angiogenesis of the venous and lymphatic vascular systems during embryogenesis, and also in the maintenance of differentiated lymphatic endothelium in adults. Binds and activates KDR/VEGFR2 and FLT4/VEGFR3 receptors.
Target Involvement
Lymphedema, hereditary, 1D (LMPH1D)
Target Subcellular Location
Secreted.
Target Protein Families
PDGF/VEGF growth factor family
Target Tissue Specificity
Spleen, lymph node, thymus, appendix, bone marrow, heart, placenta, ovary, skeletal muscle, prostate, testis, colon and small intestine and fetal liver, lung and kidney, but not in peripheral blood lymphocyte.
Target Research Area
Cancer
Target Synonyms
Flt 4L; Flt4 ligand; FLT4 ligand DHM; Flt4-L; Flt4L; Vascular endothelial growth factor C; Vascular endothelial growth factor related protein; Vascular endothelial growth factor-related protein; VEGF C; VEGF-C; Vegfc; VEGFC_HUMAN; VRP
Target Background
The protein encoded by this gene is a member of the platelet-derived growth factor/vascular endothelial growth factor (PDGF/VEGF) family. The encoded protein promotes angiogenesis and endothelial cell growth, and can also affect the permeability of blood vessels. The proprotein is further cleaved into a fully processed form that can bind and activate VEGFR-2 and VEGFR-3 receptors.
Notification