Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against VGLL3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 226-326 of human VGLL3 (NP_057290.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against VGLL3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 226-326 of human VGLL3 (NP_057290.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
Western blot analysis of various lysates, using VGLL3 Rabbit pAb at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.
| Cat.No | ADA-03553A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | VGLL3 |
| Target Synonyms | VGL3; VGL-3; VGLL3 | Form | Liquid |
| Species Reactivity | Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat lung, Rat testis | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 226-326 of human VGLL3 (NP_057290.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | YMRHHHPHAHMHHRHRHHHHHHHPPAGSALDPSYGPLLMPSVHAARIPAPQCDITKTEPTTVTSATSAWAGAFHGTVDIVPSVGFDTGLQHQDKSKESPWY | Uniprot ID | A8MV65 |
Uniprot Id
A8MV65
Target Species
Human
Target Name
VGLL3
Target Full Name
Transcription cofactor vestigial-like protein 3
Target Function
May act as a specific coactivator for the mammalian TEFs.
Target Subcellular Location
Nucleus.
Target Protein Families
Vestigial family
Target Tissue Specificity
Enriched in placenta.
Target Research Area
Epigenetics and Nuclear Signaling, Transcription
Target Synonyms
VGLL3; Transcription cofactor vestigial-like protein 3; Vgl-3
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
