-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against VPS26A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 256-327 of human VPS26A (NP_004887.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against VPS26A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 256-327 of human VPS26A (NP_004887.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-05764A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | VPS26A |
| Target Synonyms | HB58; PEP8A; VPS26; Hbeta58; VPS26A | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse testis, Rat testis, U-937 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 256-327 of human VPS26A (NP_004887.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DPTPTMRDVNKKFSVRYFLNLVLVDEEDRRYFKQQEIILWRKAPEKLRKQRTNFHQRFESPESQASAEQPEM | Uniprot ID | O75436 |
Uniprot Id
O75436
Target Species
Human
Target Name
VPS26A
Target Full Name
Vacuolar protein sorting-associated protein 26A
Target Function
Acts as component of the retromer cargo-selective complex (CSC). The CSC is believed to be the core functional component of retromer or respective retromer complex variants acting to prevent missorting of selected transmembrane cargo proteins into the lysosomal degradation pathway. The recruitment of the CSC to the endosomal membrane involves RAB7A and SNX3. The SNX-BAR retromer mediates retrograde transport of cargo proteins from endosomes to the trans-Golgi network (TGN) and is involved in endosome-to-plasma membrane transport for cargo protein recycling. The SNX3-retromer mediates the retrograde endosome-to-TGN transport of WLS distinct from the SNX-BAR retromer pathway. The SNX27-retromer is believed to be involved in endosome-to-plasma membrane trafficking and recycling of a broad spectrum of cargo proteins. The CSC seems to act as recruitment hub for other proteins, such as the WASH complex and TBC1D5. Required for retrograde transport of lysosomal enzyme receptor IGF2R. Required to regulate transcytosis of the polymeric immunoglobulin receptor (pIgR-pIgA). Required for the endosomal localization of WASHC2A (indicative for the WASH complex). Required for the endosomal localization of TBC1D5. Mediates retromer cargo recognition of SORL1 and is involved in trafficking of SORL1 implicated in sorting and processing of APP. Involved in retromer-independent lysosomal sorting of F2R. Involved in recycling of ADRB2. Enhances the affinity of SNX27 for PDZ-binding motifs in cargo proteins.
Target Subcellular Location
Cytoplasm. Endosome membrane; Peripheral membrane protein. Early endosome.
Target Protein Families
VPS26 family
Target Synonyms
FLJ12930; HB 58; HB58; Hbeta 58; Hbeta 58 homolog; Hbeta58; Hbeta58 homolog; hVPS 26; hVPS26; MGC94168; PEP 8A; PEP8A; Vacuolar protein sorting 26 A; Vacuolar protein sorting 26; Vacuolar protein sorting 26 homolog A; Vacuolar protein sorting 26 homolog A S. pombe; Vacuolar protein sorting 26 homolog A yeast; Vacuolar protein sorting 26 yeast; Vacuolar protein sorting 26 yeast homolog; Vacuolar protein sorting 26A; Vacuolar protein sorting associated protein 26A; Vacuolar protein sorting-associated protein 26A; Vesicle protein sorting 26; Vesicle protein sorting 26A; VP26A_HUMAN; VPS 26; VPS 26A; VPS26A
Target Background
This gene belongs to a group of vacuolar protein sorting (VPS) genes. The encoded protein is a component of a large multimeric complex, termed the retromer complex, involved in retrograde transport of proteins from endosomes to the trans-Golgi network. The close structural similarity between the yeast and human proteins that make up this complex suggests a similarity in function. Expression studies in yeast and mammalian cells indicate that this protein interacts directly with VPS35, which serves as the core of the retromer complex. Alternative splicing results in multiple transcript variants encoding different isoforms.
Notification