Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against VPS28 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 122-221 of human VPS28 (Q9UK41) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against VPS28 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 122-221 of human VPS28 (Q9UK41) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-14375A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | VPS28 |
| Target Synonyms | VPS28; ESCRT-I subunit | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Rat brain, Mouse brain, Mouse lung, Rat kidney, Rat lung, THP-1 | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 122-221 of human VPS28 (Q9UK41). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KGNLNRCIADVVSLFITVMDKLRLEIRAMDEIQPDLRELMETMHRMSHLPPDFEGRQTVSQWLQTLSGMSASDELDDSQVRQMLFDLESAYNAFNRFLHA | Uniprot ID | Q9UK41 |
Uniprot Id
Q9UK41
Target Species
Human
Target Name
VPS28
Target Full Name
Vacuolar protein sorting-associated protein 28 homolog
Target Function
Component of the ESCRT-I complex, a regulator of vesicular trafficking process.
Target Subcellular Location
Cell membrane. Late endosome membrane; Peripheral membrane protein.
Target Protein Families
VPS28 family
Target Synonyms
ESCRT-I complex subunit VPS28; H-Vps28; Vacuolar protein sorting 28; Vacuolar protein sorting 28 (yeast); Vacuolar protein sorting 28 homolog (S. cerevisiae); Vacuolar protein sorting 28 homolog; Vacuolar protein sorting-associated protein 28 homolog; VPS 28; Vps28; VPS28_HUMAN; Yeast class E protein Vps28p homolog
Target Background
This gene encodes a protein subunit of the ESCRT-I complex (endosomal complexes required for transport), which functions in the transport and sorting of proteins into subcellular vesicles. This complex can also be hijacked to facilitate the budding of enveloped viruses from the cell membrane. Alternative splicing results in multiple transcript variants encoding different isoforms.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
