-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against VPS4B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human VPS4B (NP_004860.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against VPS4B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human VPS4B (NP_004860.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04858A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | VPS4B |
| Target Synonyms | MIG1; SKD1; SKD1B; VPS4-2; VPS4B | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Mouse kidney | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human VPS4B (NP_004860.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSSTSPNLQKAIDLASKAAQEDKAGNYEEALQLYQHAVQYFLHVVKYEAQGDKAKQSIRAKCTEYLDRAEKLKEYLKNKEKKAQKPVKEGQPSPADEKGNDSDGEGESDDPEKKKLQNQLQGAIVIERPN | Uniprot ID | O75351 |
Uniprot Id
O75351
Target Species
Human
Target Name
VPS4B
Target Full Name
Vacuolar protein sorting-associated protein 4B
Target Function
Involved in late steps of the endosomal multivesicular bodies (MVB) pathway. Recognizes membrane-associated ESCRT-III assemblies and catalyzes their disassembly, possibly in combination with membrane fission. Redistributes the ESCRT-III components to the cytoplasm for further rounds of MVB sorting. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes enabling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids. VPS4A/B are required for the exosomal release of SDCBP, CD63 and syndecan.; (Microbial infection) In conjunction with the ESCRT machinery also appears to function in topologically equivalent membrane fission events, such as the terminal stages of cytokinesis and enveloped virus budding (HIV-1 and other lentiviruses).
Target Subcellular Location
Late endosome membrane; Peripheral membrane protein.
Target Protein Families
AAA ATPase family
Target Tissue Specificity
Ubiquitously expressed.
Target Synonyms
8030489C12Rik; Cell migration inducing 1; Cell migration-inducing gene 1 protein; MGC116271; MIG1; Protein SKD1; Skd1; SKD1B; Suppressor of K(+) transport growth defect 1; Suppressor of K+ transport defect 1; Vacuolar protein sorting 4 homolog B (S. cerevisiae); Vacuolar protein sorting 4 homolog B; Vacuolar protein sorting 4b; Vacuolar protein sorting-associated protein 4B; Vacuolar protein sorting-associating protein 4B; VPS4 2; VPS42; Vps4b; VPS4B_HUMAN
Target Background
The protein encoded by this gene is a member of the AAA protein family (ATPases associated with diverse cellular activities), and is the homolog of the yeast Vps4 protein. In humans, two paralogs of the yeast protein have been identified. The former share a high degree of aa sequence similarity with each other, and also with yeast Vps4 and mouse Skd1 proteins. Mouse Skd1 (suppressor of K+ transport defect 1) has been shown to be a yeast Vps4 ortholog. Functional studies indicate that both human paralogs associate with the endosomal compartments, and are involved in intracellular protein trafficking, similar to Vps4 protein in yeast. The gene encoding this paralog has been mapped to chromosome 18; the gene for the other resides on chromosome 16.
Notification