-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against VSNL1/VILIP-1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 2-191 of human VSNL1/VILIP-1 (NP_003376.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against VSNL1/VILIP-1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 2-191 of human VSNL1/VILIP-1 (NP_003376.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-04264A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | VSNL1/VILIP-1 |
| Target Synonyms | HLP3; VILIP; HPCAL3; HUVISL1; VILIP-1; VSNL1/VILIP-1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, HepG2, Mouse brain, U-937(negative) | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 2-191 of human VSNL1/VILIP-1 (NP_003376.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GKQNSKLAPEVMEDLVKSTEFNEHELKQWYKGFLKDCPSGRLNLEEFQQLYVKFFPYGDASKFAQHAFRTFDKNGDGTIDFREFICALSITSRGSFEQKLNWAFNMYDLDGDGKITRVEMLEIIEAIYKMVGTVIMMKMNEDGLTPEQRVDKIFSKMDKNKDDQITLDEFKEAAKSDPSIVLLLQCDIQK | Uniprot ID | P62760 |
Uniprot Id
P62760
Target Species
Human
Target Name
VSNL1
Target Full Name
Visinin-like protein 1
Target Function
Regulates (in vitro) the inhibition of rhodopsin phosphorylation in a calcium-dependent manner.
Target Protein Families
Recoverin family
Target Tissue Specificity
Brain and retina. Neuron-specific in the central and peripheral nervous system. Increased in the cerebrospinal fluid of Alzheimer disease patients (at protein level).
Target Research Area
Signal Transduction
Target Synonyms
21 kDa CABP; Hippocalcin like protein 3; Hippocalcin-like protein 3; HLP 3; HLP3; HPCAL 3; HPCAL3; HUVISL1; Neural visinin-like protein 1; Neural visinin-like type 1 protein; Neurocalcin alpha; NVL 1; NVL1; Nvp1; OZ1; Ratnvp1; VILIP; VILIP-1; Visinin; Visinin like 1; Visinin like protein 1; Visinin-like protein 1; VISL 1; VISL1; VISL1_HUMAN; VLP-1; Vnsl1; Vsnl1
Target Background
This gene is a member of the visinin/recoverin subfamily of neuronal calcium sensor proteins. The encoded protein is strongly expressed in granule cells of the cerebellum where it associates with membranes in a calcium-dependent manner and modulates intracellular signaling pathways of the central nervous system by directly or indirectly regulating the activity of adenylyl cyclase. Alternatively spliced transcript variants have been observed, but their full-length nature has not been determined.
Notification