Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against WASF3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human WASF3 (NP_001278894.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against WASF3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human WASF3 (NP_001278894.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01705A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | WASF3 |
| Target Synonyms | SCAR3; WAVE3; Brush-1; WASF3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human WASF3 (NP_001278894.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RTRKEEWERRKMGIEFMSDAKKLEQAGSAKEDRVPSGSHASDVTDYSYPATPNHSLHPQPVTPSYAAGDVPPHGPASQAAEHEYRPPSASARHMALNRPQQ | Uniprot ID | Q9UPY6 |
Uniprot Id
Q9UPY6
Target Species
Human
Target Name
WASF3
Target Full Name
Actin-binding protein WASF3
Target Function
Downstream effector molecules involved in the transmission of signals from tyrosine kinase receptors and small GTPases to the actin cytoskeleton. Plays a role in the regulation of cell morphology and cytoskeletal organization. Required in the control of cell shape.
Target Subcellular Location
Cytoplasm, cytoskeleton.
Target Protein Families
SCAR/WAVE family
Target Tissue Specificity
Expressed in ovary and brain.
Target Synonyms
KIAA0900; Protein WAVE-3; Protein WAVE3; SCAR3; Verprolin homology domain containing protein 3; Verprolin homology domain-containing protein 3; WASF3; WASF3_HUMAN; WASP family protein member 3; WAVE3; Wiskott Aldrich syndrome protein family member 3; Wiskott-Aldrich syndrome protein family member 3
Target Background
This gene encodes a member of the Wiskott-Aldrich syndrome protein family. The gene product is a protein that forms a multiprotein complex that links receptor kinases and actin. Binding to actin occurs through a C-terminal verprolin homology domain in all family members. The multiprotein complex serves to tranduce signals that involve changes in cell shape, motility or function. A pseudogene of this gene have been defined on chromosome 6. Alternative splicing results in multiple transcript variants
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
