-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against WDR77 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 153-243 of human WDR77 (NP_077007.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against WDR77 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 153-243 of human WDR77 (NP_077007.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-02664A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | WDR77 |
| Target Synonyms | p44; MEP50; MEP-50; HKMT1069; Nbla10071; p44/Mep50; WDR77 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T, Mouse brain, U2OS | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 153-243 of human WDR77 (NP_077007.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DLAQQVVLSSYRAHAAQVTCVAASPHKDSVFLSCSEDNRILLWDTRCPKPASQIGCSAPGYLPTSLAWHPQQSEVFVFGDENGTVSLVDTK | Uniprot ID | Q9BQA1 |
Uniprot Id
Q9BQA1
Target Species
Human
Target Name
WDR77
Target Full Name
Methylosome protein WDR77
Target Function
Non-catalytic component of the methylosome complex, composed of PRMT5, WDR77 and CLNS1A, which modifies specific arginines to dimethylarginines in several spliceosomal Sm proteins and histones. This modification targets Sm proteins to the survival of motor neurons (SMN) complex for assembly into small nuclear ribonucleoprotein core particles. Might play a role in transcription regulation. The methylosome complex also methylates the Piwi proteins (PIWIL1, PIWIL2 and PIWIL4), methylation of Piwi proteins being required for the interaction with Tudor domain-containing proteins and subsequent localization to the meiotic nuage.
Target Subcellular Location
Nucleus. Cytoplasm.
Target Tissue Specificity
Highly expressed in heart, skeletal muscle, spleen, testis, uterus, prostate and thymus. In testis, expressed in germ cells and Leydig cells, but not in peritubular myocytes, nor in Sertoli cells. Expressed in prostate cancers, in seminomas and in Leydig
Target Synonyms
2610312E17Rik; Androgen receptor cofactor p44; C79984; HKMT1069; MEP 50; MEP-50; MEP50; MEP50_HUMAN; Methylosome protein 50; MGC2722; Nbla10071; p44; p44/Mep50; RGD1310479 ; RP11 552M11.3; WD repeat containing protein 77; WD repeat domain 77 ; WD repeat-containing protein 77; WDR77
Target Background
The protein encoded by this gene is an androgen receptor coactivator that forms a complex with protein arginine methyltransferase 5, which modifies specific arginines to dimethylarginines in several spliceosomal Sm proteins. The encoded protein may be involved in the early stages of prostate cancer, with most of the protein being nuclear-localized in benign cells but cytoplasmic in cancer cells. Several transcript variants encoding different isoforms have been found for this gene.
Notification