Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against WFDC1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 111-220 of human WFDC1 (NP_067020.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against WFDC1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 111-220 of human WFDC1 (NP_067020.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-02319A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | WFDC1 |
| Target Synonyms | PS20; WFDC1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, Mouse brain, Mouse lung, SGC-7901 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 111-220 of human WFDC1 (NP_067020.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PPVLDWLVQPKPRWLGGNGWLLDGPEEVLQAEACSTTEDGAEPLLCPSGYECHILSPGDVAEGIPNRGQCVKQRRQADGRILRHKLYKEYPEGDSKNVAEPGRGQQKHFQ | Uniprot ID | Q9HC57 |
Uniprot Id
Q9HC57
Target Species
Human
Target Name
WFDC1
Target Full Name
WAP four-disulfide core domain protein 1
Target Function
Has growth inhibitory activity.
Target Subcellular Location
Secreted.
Target Synonyms
Prostate stromal protein ps20; PS20; ps20 growth inhibitor; WAP four disulfide core domain 1; WAP four disulfide core domain 1 homolog; WAP four-disulfide core domain protein 1; Wfdc1; WFDC1_HUMAN
Target Background
This gene encodes a member of the WAP-type four disulfide core domain family. The WAP-type four-disulfide core domain contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor in many family members. This gene is mapped to chromosome 16q24, an area of frequent loss of heterozygosity in cancers, including prostate, breast and hepatocellular cancers and Wilms' tumor. This gene is downregulated in many cancer types and may be involved in the inhibition of cell proliferation. The encoded protein may also play a role in the susceptibility of certain CD4 memory T cells to human immunodeficiency virus infection. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
