-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against WNT10B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 260-340 of human WNT10B (NP_003385.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against WNT10B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 260-340 of human WNT10B (NP_003385.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-10391A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | WNT10B |
| Target Synonyms | SHFM6; STHAG8; WNT-12; WNT10B | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 260-340 of human WNT10B (NP_003385.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TCWRAAPEFRAVGAALRERLGRAIFIDTHNRNSGAFQPRLRPRRLSGELVYFEKSPDFCERDPTMGSPGTRGRACNKTSRL | Uniprot ID | O00744 |
Uniprot Id
O00744
Target Species
Human
Target Name
WNT10B
Target Full Name
Protein Wnt-10b
Target Function
Member of the Wnt ligand gene family that encodes for secreted proteins, which activate the Wnt signaling cascade. Specifically activates canonical Wnt/beta-catenin signaling and thus triggers beta-catenin/LEF/TCF-mediated transcriptional programs. Involved in signaling networks controlling stemness, pluripotency and cell fate decisions. Acts in the immune system, mammary gland, adipose tissue, bone and skin.
Target Involvement
Split-hand/foot malformation 6 (SHFM6); Tooth agenesis, selective, 8 (STHAG8)
Target Subcellular Location
Secreted, extracellular space, extracellular matrix. Secreted.
Target Protein Families
Wnt family
Target Tissue Specificity
Detected in most adult tissues. Highest levels were found in heart and skeletal muscle. Low levels are found in brain.
Target Synonyms
Protein Wnt-10b; Protein Wnt-12; SHFM6; wingless type MMTV integration site family; member 10B; WN10B_HUMAN; WNT 10B protein; WNT 12; Wnt10b; wnt12
Target Background
The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family. It may be involved in breast cancer, and its protein signaling is likely a molecular switch that governs adipogenesis. This protein is 96% identical to the mouse Wnt10b protein at the amino acid level. This gene is clustered with another family member, WNT1, in the chromosome 12q13 region.
Notification