Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against WWOX was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human WWOX (NP_057457.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against WWOX was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human WWOX (NP_057457.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-09534A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | WWOX |
| Target Synonyms | FOR; WOX1; DEE28; EIEE28; FRA16D; SCAR12; HHCMA56; PRO0128; SDR41C1; D16S432E; WWOX | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, HT-29, Jurkat, LO2, SKOV3 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human WWOX (NP_057457.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAALRYAGLDDTDSEDELPPGWEERTTKDGWVYYANHTEEKTQWEHPKTGKRKRVAGDLPYGWEQETDENGQVFFVDHINKRTTYLDPRLAFTVDDNPTKPTTRQRYDGSTTAMEILQGR | Uniprot ID | Q9NZC7 |
Uniprot Id
Q9NZC7
Target Species
Human
Target Name
WWOX
Target Full Name
WW domain-containing oxidoreductase
Target Function
Putative oxidoreductase. Acts as a tumor suppressor and plays a role in apoptosis. Required for normal bone development. May function synergistically with p53/TP53 to control genotoxic stress-induced cell death. Plays a role in TGFB1 signaling and TGFB1-mediated cell death. May also play a role in tumor necrosis factor (TNF)-mediated cell death. Inhibits Wnt signaling, probably by sequestering DVL2 in the cytoplasm.
Target Involvement
Esophageal cancer (ESCR); Spinocerebellar ataxia, autosomal recessive, 12 (SCAR12); Epileptic encephalopathy, early infantile, 28 (EIEE28)
Target Subcellular Location
Cytoplasm. Nucleus. Mitochondrion. Golgi apparatus.
Target Protein Families
Short-chain dehydrogenases/reductases (SDR) family
Target Tissue Specificity
Widely expressed. Strongly expressed in testis, prostate, and ovary. Overexpressed in cancer cell lines. Isoform 5 and isoform 6 may only be expressed in tumor cell lines.
Target Synonyms
5330426P09Rik; 9030416C10Rik; Aberrant WW domain-containing oxidoreductase; D16S432E; EC 1.1.1.-; EIEE28; FOR; FRA16D; Fragile site FRA16D oxidoreductase; Fragile site FRA16D Oxireductase; HHCMA56; MGC55975; PRO0128; Putative oxidoreductase; SCAR12; SDR41C1; Short chain dehydrogenase/reductase family 41C, member 1; WOX1; WW domain containing oxidoreductase; WW domain-containing oxidoreductase; WW domain-containing protein WWOX; wwox; WWOX_HUMAN; zgc:55975
Target Background
This gene encodes a member of the short-chain dehydrogenases/reductases (SDR) protein family. This gene spans the FRA16D common chromosomal fragile site and appears to function as a tumor suppressor gene. Expression of the encoded protein is able to induce apoptosis, while defects in this gene are associated with multiple types of cancer. Disruption of this gene is also associated with autosomal recessive spinocerebellar ataxia 12. Disruption of a similar gene in mouse results in impaired steroidogenesis, additionally suggesting a metabolic function for the protein. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
