Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against XK was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 59-138 of human XK (NP_066569.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against XK was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 59-138 of human XK (NP_066569.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-05268A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | XK |
| Target Synonyms | KX; NA; NAC; X1k; XKR1; XK | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse pancreas, Rat pancreas | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 59-138 of human XK (NP_066569.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | HRDLSRDRPLVLLLHLLQLGPLFRCFEVFCIYFQSGNNEEPYVSITKKRQMPKNGLSEEIEKEVGQAEGKLITHRSAFSR | Uniprot ID | P51811 |
Uniprot Id
P51811
Target Species
Human
Target Name
XK
Target Full Name
Endoplasmic reticulum membrane adapter protein XK
Target Function
May be involved in sodium-dependent transport of neutral amino acids or oligopeptides.
Target Involvement
McLeod syndrome (MLS)
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
XK family
Target Tissue Specificity
High levels in skeletal muscle, heart, brain, and pancreas; low levels in placenta, lung, liver, and kidney.
Target Synonyms
XK; XKR1; XRG1; Membrane transport protein XK; Kell complex 37 kDa component; Kx antigen; XK-related protein 1
Target Background
This locus controls the synthesis of the Kell blood group 'precursor substance' (Kx). Mutations in this gene have been associated with McLeod syndrome, an X-linked, recessive disorder characterized by abnormalities in the neuromuscular and hematopoietic systems. The encoded protein has structural characteristics of prokaryotic and eukaryotic membrane transport proteins.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
