Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against XPNPEP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 44-240 of human XPNPEP1 (NP_065116.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against XPNPEP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 44-240 of human XPNPEP1 (NP_065116.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05137A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | XPNPEP1 |
| Target Synonyms | APP1; SAMP; XPNPEP; XPNPEPL; XPNPEPL1; XPNPEP1 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, LO2, Rat liver, Rat testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 44-240 of human XPNPEP1 (NP_065116.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MPPKVTSELLRQLRQAMRNSEYVTEPIQAYIIPSGDAHQSEYIAPCDCRRAFVSGFDGSAGTAIITEEHAAMWTDGRYFLQAAKQMDSNWTLMKMGLKDTPTQEDWLVSVLPEGSRVGVDPLIIPTDYWKKMAKVLRSAGHHLIPVKENLVDKIWTDRPERPCKPLLTLGLDYTGISWKDKVADLRLKMAERNVMWF | Uniprot ID | Q9NQW7 |
Uniprot Id
Q9NQW7
Target Species
Human
Target Name
XPNPEP1
Target Full Name
Xaa-Pro aminopeptidase 1
Target Function
Contributes to the degradation of bradykinin. Catalyzes the removal of a penultimate prolyl residue from the N-termini of peptides, such as Arg-Pro-Pro.
Target Subcellular Location
Cytoplasm.
Target Protein Families
Peptidase M24B family
Target Tissue Specificity
Expressed in all tissues tested, including pancreas, heart, muscle, kidney, liver, lung and brain. Highest levels in pancreas.
Target Synonyms
Aminoacylproline aminopeptidase; aminopeptidase P, cytosolic; APP1; Cytosolic aminopeptidase P; RP11 451M19.1; sAmp; Soluble aminopeptidase P; soluble; X Pro aminopeptidase 1; X prolyl aminopeptidase (aminopeptidase P) 1; X prolyl aminopeptidase (Aminopeptidase P) 1 soluble; X prolyl aminopeptidase 1; X prolyl aminopeptidase 1 soluble; X-Pro aminopeptidase 1; X-prolyl aminopeptidase 1; Xaa Pro aminopeptidase 1; Xaa-Pro aminopeptidase 1; XPNPEP 1; XPNPEP; xpnpep1; XPNPEPL; XPNPEPL1; XPP1_HUMAN
Target Background
This gene encodes the cytosolic form of a metalloaminopeptidase that catalyzes the cleavage of the N-terminal amino acid adjacent to a proline residue. The gene product may play a role in degradation and maturation of tachykinins, neuropeptides, and peptide hormones. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
