Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ZC3H12C was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 735-883 of human ZC3H12C (NP_203748.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against ZC3H12C was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 735-883 of human ZC3H12C (NP_203748.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-07507A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ZC3H12C |
| Target Synonyms | MCPIP3; ZC3H12C | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, RAW264.7, U-87MG | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 735-883 of human ZC3H12C (NP_203748.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KAPHLGRSLVATRIDSISDSRLYDSSPSRQRKPYSRQEGLGSWERPGYGIDAYGYRQTYSLPDNSTQPCYEQFTFQSLPEQQEPAWRIPYCGMPQDPPRYQDNREKIYINLCNIFPPDLVRIVMKRNPHMTDAQQLAAAILVEKSQLGY | Uniprot ID | Q9C0D7 |
Uniprot Id
Q9C0D7
Target Species
Human
Target Name
ZC3H12C
Target Full Name
Probable ribonuclease ZC3H12C
Target Function
May function as RNase and regulate the levels of target RNA species.
Target Protein Families
ZC3H12 family
Target Synonyms
MCP induced protein 3; MCP-induced protein 3; MCPIP3; Probable ribonuclease ZC3H12C; ZC12C_HUMAN; ZC3H12C; Zinc finger CCCH domain-containing protein 12C
Target Background
Predicted to enable endoribonuclease activity and mRNA binding activity. Predicted to be involved in RNA phosphodiester bond hydrolysis, endonucleolytic. Predicted to be active in cytoplasmic ribonucleoprotein granule and nucleus.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
