Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ZDHHC5 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 130-230 of human ZDHHC5 (NP_056272.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ZDHHC5 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 130-230 of human ZDHHC5 (NP_056272.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10544A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ZDHHC5 |
| Target Synonyms | DHHC5; ZNF375; ZDHHC5 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | U-87MG | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 130-230 of human ZDHHC5 (NP_056272.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FDHHCPWVNNCIGRRNYRYFFLFLLSLTAHIMGVFGFGLLYVLYHIEELSGVRTAVTMAVMCVAGLFFIPVAGLTGFHVVLVARGRTTNEQVTGKFRGGVN | Uniprot ID | Q9C0B5 |
Uniprot Id
Q9C0B5
Target Species
Human
Target Name
ZDHHC5
Target Full Name
Palmitoyltransferase ZDHHC5
Target Function
Palmitoyltransferase that catalyzes the addition of palmitate onto various protein substrates and is involved in a variety of cellular processes. Palmitoylates the G-protein coupled receptor SSTR5 and for FLOT2.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
DHHC palmitoyltransferase family, ERF2/ZDHHC9 subfamily
Target Research Area
Cell Biology
Target Synonyms
ZDHHC5; KIAA1748; ZNF375; Palmitoyltransferase ZDHHC5; Zinc finger DHHC domain-containing protein 5; DHHC-5; Zinc finger protein 375
Target Background
Enables palmitoyltransferase activity. Involved in positive regulation of pattern recognition receptor signaling pathway and positive regulation of protein localization to plasma membrane. Acts upstream of or within protein palmitoylation. Located in phagocytic vesicle and plasma membrane.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
