-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ZEB1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 800-900 of human ZEB1 (NP_110378.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ZEB1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 800-900 of human ZEB1 (NP_110378.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14833A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ZEB1 |
| Target Synonyms | BZP; TCF8; AREB6; FECD6; NIL2A; PPCD3; ZFHEP; ZFHX1A; DELTAEF1; B1 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat heart, Jurkat | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 800-900 of human ZEB1 (NP_110378.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | INIAIPTVTAQLPTIVAIADQNSVPCLRALAANKQTILIPQVAYTYSTTVSPAVQEPPLKVIQPNGNQDERQDTSSEGVSNVEDQNDSDSTPPKKKMRKTE | Uniprot ID | P37275 |
Uniprot Id
P37275
Target Species
Human
Target Name
ZEB1
Target Full Name
Zinc finger E-box-binding homeobox 1
Target Function
Acts as a transcriptional repressor. Inhibits interleukin-2 (IL-2) gene expression. Enhances or represses the promoter activity of the ATP1A1 gene depending on the quantity of cDNA and on the cell type. Represses E-cadherin promoter and induces an epithelial-mesenchymal transition (EMT) by recruiting SMARCA4/BRG1. Represses BCL6 transcription in the presence of the corepressor CTBP1. Positively regulates neuronal differentiation. Represses RCOR1 transcription activation during neurogenesis. Represses transcription by binding to the E box (5'-CANNTG-3'). Promotes tumorigenicity by repressing stemness-inhibiting microRNAs.
Target Involvement
Corneal dystrophy, posterior polymorphous, 3 (PPCD3); Corneal dystrophy, Fuchs endothelial, 6 (FECD6)
Target Subcellular Location
Nucleus.
Target Protein Families
Delta-EF1/ZFH-1 C2H2-type zinc-finger family
Target Tissue Specificity
Colocalizes with SMARCA4/BRG1 in E-cadherin-negative cells from established lines, and stroma of normal colon as well as in de-differentiated epithelial cells at the invasion front of colorectal carcinomas (at protein level). Expressed in heart and skelet
Target Synonyms
AREB 6; AREB6; BZP; Delta crystallin enhancer binding factor 1; DELTA EF1; FECD6; MGC133261; Negative regulator of IL 2; Negative regulator of IL2; NIL 2 A; NIL 2 A zinc finger protein; NIL 2A; NIL-2-A zinc finger protein; NIL2A; Posterior polymorphous corneal dystrophy 3; PPCD3; Represses interleukin 2 expression; TCF 8; TCF-8; TCF8; Transcription factor 8 (represses interleukin 2 expression); Transcription factor 8; ZEB 1; ZEB; ZEB1; ZEB1_HUMAN; ZFHEP; ZFHX 1A; ZFHX1A; Zinc finger E box binding homeobox 1; Zinc finger E-box-binding homeobox 1; Zinc finger homeodomain enhancer binding protein
Target Background
This gene encodes a zinc finger transcription factor. The encoded protein likely plays a role in transcriptional repression of interleukin 2. Mutations in this gene have been associated with posterior polymorphous corneal dystrophy-3 and late-onset Fuchs endothelial corneal dystrophy. Alternatively spliced transcript variants encoding different isoforms have been described.
Notification