-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ZIP8 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 180-300 of human ZIP8 (NP_071437.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against ZIP8 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 180-300 of human ZIP8 (NP_071437.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-10921A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ZIP8 |
| Target Synonyms | ZIP8; CDG2N; PP3105; BIGM103; LZT-Hs6 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, HL-60, Mouse liver, NCI-H460 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 180-300 of human ZIP8 (NP_071437.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QLIPEAFGFDPKVDSYVEKAVAVFGGFYLLFFFERMLKMLLKTYGQNGHTHFGNDNFGPQEKTHQPKALPAINGVTCYANPAVTEANGHIHFDNVSVVSLQDGKKEPSSCTCLKGPKLSEI | Uniprot ID | Q9C0K1 |
Uniprot Id
Q9C0K1
Target Species
Human
Target Name
SLC39A8
Target Full Name
Metal cation symporter ZIP8
Target Function
Electroneutral transporter of the plasma membrane mediating the cellular uptake of zinc and manganese, two divalent metal cations important for development, tissue homeostasis or immunity. Functions as an energy-dependent symporter, transporting through the membranes an electroneutral complex composed of a divalent metal cation, a bicarbonate and a selenite anion or yet a metal cation and two bicarbonate anions. May also transport iron, mercury and cobalt through membranes. Beside these endogenous cellular substrates, also imports cadmium a non-essential metal which is cytotoxic and carcinogenic. Through zinc import, indirectly regulates the metal-dependent transcription factor MTF1 and the expression of some metalloproteases involved in cartilage catabolism and also probably heart development. Also indirectly regulates the expression of proteins involved in cell morphology and cytoskeleton organization. Indirectly controls innate immune function and inflammatory response by regulating zinc cellular uptake which in turn modulates the expression of genes specific of these processes. Protects, for instance, cells from injury and death at the onset of inflammation. By regulating zinc influx into monocytes also directly modulates their adhesion to endothelial cells and arteries. At the apical membrane of hepatocytes, reclaims manganese from the bile and regulates, through the systemic levels of the nutrient, the activity of manganese-dependent enzymes. Also participates in manganese reabsorption in the proximal tubule of the kidney. By mediating the extracellular uptake of manganese by cells of the blood-brain barrier, may also play a role in the transport of the micronutrient to the brain. Through manganese cellular uptake also participates in mitochondrial proper function. Finally, also probably functions intracellularly, translocating zinc from lysosome to cytosol to indirectly enhance the expression of specific genes during TCR-mediated T cell activation.
Target Involvement
Congenital disorder of glycosylation 2N (CDG2N)
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Lysosome membrane; Multi-pass membrane protein. Apical cell membrane; Multi-pass membrane protein. Basolateral cell membrane; Multi-pass membrane protein.
Target Protein Families
ZIP transporter (TC 2.A.5) family
Target Tissue Specificity
Ubiquitously expressed. Expressed in thymus, placenta, lung, liver, pancreas, salivary gland and, to a lower extent, in spleen, testis, ovary, small intestine, colon, leukocyte, heart. Highest expression is observed in pancreas. Expressed by macrophages (
Target Synonyms
SLC39A8; BIGM103; ZIP8; PP3105; Zinc transporter ZIP8; BCG-induced integral membrane protein in monocyte clone 103 protein; LIV-1 subfamily of ZIP zinc transporter 6; LZT-Hs6; Solute carrier family 39 member 8; Zrt- and Irt-like protein 8; ZIP-8
Target Background
This gene encodes a member of the SLC39 family of solute-carrier genes, which show structural characteristics of zinc transporters. The encoded protein is glycosylated and found in the plasma membrane and mitochondria, and functions in the cellular import of zinc at the onset of inflammation. It is also thought to be the primary transporter of the toxic cation cadmium, which is found in cigarette smoke. Multiple transcript variants encoding different isoforms have been found for this gene. Additional alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known.
Notification