Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ZMPSTE24 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human ZMPSTE24 (NP_005848.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against ZMPSTE24 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human ZMPSTE24 (NP_005848.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-01732A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ZMPSTE24 |
| Target Synonyms | HGPS; PRO1; FACE1; RSDM1; STE24; FACE-1; Ste24p; ZMPSTE24 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | SKOV3 | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human ZMPSTE24 (NP_005848.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AWLFTLVVSLVLVTIYADYIAPLFDKFTPLPEGKLKEEIEVMAKSIDFPLTKVYVVEGSKRSSHSNAYFYGFFKNKRIVLFDTLLEEYSVLNKDIQEDSGM | Uniprot ID | O75844 |
Uniprot Id
O75844
Target Species
Human
Target Name
ZMPSTE24
Target Full Name
CAAX prenyl protease 1 homolog
Target Function
Proteolytically removes the C-terminal three residues of farnesylated proteins. Acts on lamin A/C.
Target Involvement
Mandibuloacral dysplasia with type B lipodystrophy (MADB); Lethal tight skin contracture syndrome (LTSCS)
Target Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Nucleus inner membrane; Multi-pass membrane protein.
Target Protein Families
Peptidase M48A family
Target Tissue Specificity
Widely expressed. High levels in kidney, prostate, testis and ovary.
Target Synonyms
ZMPSTE24; FACE1; STE24; CAAX prenyl protease 1 homolog; Farnesylated proteins-converting enzyme 1; FACE-1; Prenyl protein-specific endoprotease 1; Zinc metalloproteinase Ste24 homolog
Target Background
This gene encodes a member of the peptidase M48A family. The encoded protein is a zinc metalloproteinase involved in the two step post-translational proteolytic cleavage of carboxy terminal residues of farnesylated prelamin A to form mature lamin A. Mutations in this gene have been associated with mandibuloacral dysplasia and restrictive dermopathy.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
