Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ZNF24 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 169-368 of human ZNF24 (NP_008896.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ZNF24 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 169-368 of human ZNF24 (NP_008896.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02462A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ZNF24 |
| Target Synonyms | KOX17; RSG-A; ZNF191; ZSCAN3; Zfp191; ZNF24 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Rat heart | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 169-368 of human ZNF24 (NP_008896.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LDAVENQLKWASWELHSLRHCDDDGRTENGALAPKQELPSALESHEVPGTLNMGVPQIFKYGETCFPKGRFERKRNPSRKKQHICDECGKHFSQGSALILHQRIHSGEKPYGCVECGKAFSRSSILVQHQRVHTGEKPYKCLECGKAFSQNSGLINHQRIHTGEKPYECVQCGKSYSQSSNLFRHQRRHNAEKLLNVVKV | Uniprot ID | P17028 |
Uniprot Id
P17028
Target Species
Human
Target Name
ZNF24
Target Full Name
Zinc finger protein 24
Target Function
Transcription factor required for myelination of differentiated oligodendrocytes. Required for the conversion of oligodendrocytes from the premyelinating to the myelinating state. In the developing central nervous system (CNS), involved in the maintenance in the progenitor stage by promoting the cell cycle. Specifically binds to the 5'-TCAT-3' DNA sequence. Has transcription repressor activity in vitro.
Target Subcellular Location
Nucleus.
Target Protein Families
Krueppel C2H2-type zinc-finger protein family
Target Tissue Specificity
Expressed in many tissues except in heart.
Target Synonyms
KOX17; Retinoic acid suppression protein A; RSG A; RSG-A; RSGA; Zfp191; Zinc finger and SCAN domain containing protein 3; Zinc finger and SCAN domain-containing protein 3; Zinc finger protein 191; Zinc finger protein 24; Zinc finger protein KOX17; ZNF 24; ZNF191; ZNF24; ZNF24_HUMAN; ZSCAN 3; ZSCAN3
Target Background
Enables DNA-binding transcription activator activity, RNA polymerase II-specific; identical protein binding activity; and sequence-specific DNA binding activity. Involved in negative regulation of transcription, DNA-templated and positive regulation of transcription by RNA polymerase II. Located in nucleoplasm.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
