-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against KLF4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-115 of KLF4 (NP_001300981.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against KLF4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-115 of KLF4 (NP_001300981.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-11644A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | KLF4 |
| Target Synonyms | EZF; GKLF; KLF4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, HCT116, HT-29 | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-115 of KLF4 (NP_001300981.1). | Immunogen Sequence | MRQPPGESDMAVSDALLPSFSTFASGPAGREKTLRQAGAPNNRWREELSHMKRLPPVLPGRPYDLAAATVATDLESGGAGAACGGSNLAPLPRRETEEFNDLLDLDFILSNSLTH |
|---|---|---|---|
| Uniprot ID | O43474 |
Uniprot Id
O43474
Target Species
Human
Target Name
KLF4
Target Full Name
Krueppel-like factor 4
Target Function
Transcription factor; can act both as activator and as repressor. Binds the 5'-CACCC-3' core sequence. Binds to the promoter region of its own gene and can activate its own transcription. Regulates the expression of key transcription factors during embryonic development. Plays an important role in maintaining embryonic stem cells, and in preventing their differentiation. Required for establishing the barrier function of the skin and for postnatal maturation and maintenance of the ocular surface. Involved in the differentiation of epithelial cells and may also function in skeletal and kidney development. Contributes to the down-regulation of p53/TP53 transcription.
Target Subcellular Location
Nucleus.
Target Protein Families
Krueppel C2H2-type zinc-finger protein family
Target Synonyms
Endothelial Kruppel like zinc finger protein ; Epithelial zinc finger protein EZF; EZF; GKLF; gut Kruppel-like factor; Gut-enriched krueppel-like factor; KLF; KLF4; KLF4_HUMAN; Krueppel-like factor 4; Kruppel like factor 4 (Epithelial zinc finger protein EZF) (Gut enriched Krueppel like factor); Kruppel like factor 4 (gut)
Target Background
This gene encodes a protein that belongs to the Kruppel family of transcription factors. The encoded zinc finger protein is required for normal development of the barrier function of skin. The encoded protein is thought to control the G1-to-S transition of the cell cycle following DNA damage by mediating the tumor suppressor gene p53. Mice lacking this gene have a normal appearance but lose weight rapidly, and die shortly after birth due to fluid evaporation resulting from compromised epidermal barrier function. Alternative splicing results in multiple transcript variants encoding different isoforms.
Notification