-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against KLKB1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 391-500 of KLKB1 (NP_000883.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against KLKB1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 391-500 of KLKB1 (NP_000883.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-03581A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | KLKB1 |
| Target Synonyms | PKK; PPK; KLK3; PKKD; KLKB1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, BxPC-3, HT-29, Mouse liver, Mouse pancreas, Rat liver | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 391-500 of KLKB1 (NP_000883.2). | Immunogen Sequence | IVGGTNSSWGEWPWQVSLQVKLTAQRHLCGGSLIGHQWVLTAAHCFDGLPLQDVWRIYSGILNLSDITKDTPFSQIKEIIIHQNYKVSEGNHDIALIKLQAPLNYTEFQK |
|---|---|---|---|
| Uniprot ID | P03952 |
Uniprot Id
P03952
Target Species
Human
Target Name
KLKB1
Target Full Name
Plasma kallikrein
Target Function
The enzyme cleaves Lys-Arg and Arg-Ser bonds. It activates, in a reciprocal reaction, factor XII after its binding to a negatively charged surface. It also releases bradykinin from HMW kininogen and may also play a role in the renin-angiotensin system by converting prorenin into renin.
Target Involvement
Prekallikrein deficiency (PKK deficiency)
Target Subcellular Location
Secreted.
Target Protein Families
Peptidase S1 family, Plasma kallikrein subfamily
Target Research Area
Cell Biology
Target Synonyms
Fletcher factor; kallikrein B plasma; Kallikrein B plasma (Fletcher factor) 1; Kallikrein B; plasma 1; Kallikrein B1; Kininogenin; KLK3; KLKB1; KLKB1_HUMAN; PKK; PKKD; Plasma kallikrein; Plasma kallikrein B1; Plasma kallikrein light chain; Plasma prekallikrein; PPK; Prekallikrein
Target Background
This gene encodes a glycoprotein that participates in the surface-dependent activation of blood coagulation, fibrinolysis, kinin generation and inflammation. The encoded preproprotein present in plasma as a non-covalent complex with high molecular weight kininogen undergoes proteolytic processing mediated by activated coagulation factor XII to generate a disulfide-linked, heterodimeric serine protease comprised of heavy and light chains. Certain mutations in this gene cause prekallikrein deficiency. Alternative splicing results in multiple transcript variants encoding different isoforms.
Notification