-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against KYAT3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 295-394 of human KYAT3(NP_001008661.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, IF/ICC, ELISA.
The antibody against KYAT3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 295-394 of human KYAT3(NP_001008661.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-08496A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | KYAT3 |
| Target Synonyms | KAT3; CCBL2; KATIII | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 295-394 of human KYAT3(NP_001008661.1). | Immunogen Sequence | PNHLIKHLQTVQQNTIYTCATPLQEALAQAFWIDIKRMDDPECYFNSLPKELEVKRDRMVRLLESVGLKPIVPDGGYFIIADVSLLDPDLSDMKNNEPYD |
|---|---|---|---|
| Uniprot ID | Q6YP21 |
Uniprot Id
Q6YP21
Target Species
Human
Target Name
KYAT3
Target Full Name
Kynurenine--oxoglutarate transaminase 3
Target Function
Catalyzes the irreversible transamination of the L-tryptophan metabolite L-kynurenine to form kynurenic acid (KA), an intermediate in the tryptophan catabolic pathway which is also a broad spectrum antagonist of the three ionotropic excitatory amino acid receptors among others. May catalyze the beta-elimination of S-conjugates and Se-conjugates of L-(seleno)cysteine, resulting in the cleavage of the C-S or C-Se bond. Has transaminase activity towards L-kynurenine, tryptophan, phenylalanine, serine, cysteine, methionine, histidine, glutamine and asparagine with glyoxylate as an amino group acceptor (in vitro). Has lower activity with 2-oxoglutarate as amino group acceptor (in vitro).
Target Protein Families
Class-I pyridoxal-phosphate-dependent aminotransferase family
Target Research Area
Signal Transduction
Target Synonyms
CCBL 2; Cysteine conjugate beta lyase 2; Cysteine S conjugate beta lyase 2; Cysteine-S-conjugate beta-lyase 2; DKFZp547N1117; DKFZp667D0223; KAT 3; KAT III; KAT3; KAT3_HUMAN; KATIII; kyat3; Kynurenine aminotransferase 3; Kynurenine aminotransferase III; Kynurenine oxoglutarate transaminase 3; Kynurenine oxoglutarate transaminase III; Kynurenine--glyoxylate transaminase; Kynurenine--oxoglutarate transaminase 3; Kynurenine--oxoglutarate transaminase III; MGC9398; RBM1; RBMX L1; RBMXL 1; RBMXL1; RNA binding motif protein X linked like 1; RP11 82K18.3; RP4 531M19.2
Target Background
This gene encodes an aminotransferase that transaminates kynurenine to form kynurenic acid, which is a metabolite of tryptophan. Multiple alternatively spliced transcript variants that encode different proteins have been described for this gene. This gene shares 5' exon structure with the RNA binding motif protein, X-linked-like 1 locus on chromosome 1, but the coding sequences are non-overlapping.
Notification