-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LMO2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 human LMO2(NP_001135787.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against LMO2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 human LMO2(NP_001135787.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-08363A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LMO2 |
| Target Synonyms | TTG2; LMO-2; RBTN2; RHOM2; RBTNL1; LMO2 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | TF-1 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 human LMO2(NP_001135787.1). | Immunogen Sequence | MSSAIERKSLDPSEEPVDEVLQIPPSLLTCGGCQQNIGDRYFLKAIDQYWHEDCLSCDLCGCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGLCASCDKR |
|---|---|---|---|
| Uniprot ID | P25791 |
Uniprot Id
P25791
Target Species
Human
Target Name
LMO2
Target Full Name
Rhombotin-2
Target Function
Acts with TAL1/SCL to regulate red blood cell development. Also acts with LDB1 to maintain erythroid precursors in an immature state.
Target Involvement
A chromosomal aberration involving LMO2 may be a cause of a form of T-cell acute lymphoblastic leukemia (T-ALL). Translocation t(11,14)(p13;q11) with TCRD.
Target Subcellular Location
Nucleus.
Target Synonyms
Cysteine rich protein TTG 2; Cysteine rich protein TTG2; Cysteine-rich protein TTG-2; LIM domain only 2 (rhombotin like 1); LIM domain only 2; LIM domain only protein 2; LMO 2; LMO-2; lmo2; RBTN 2; RBTN L1; RBTN2; RBTN2_HUMAN; RBTNL 1; RBTNL1; RHOM 2; RHOM2; Rhombotin 2; Rhombotin like 1; Rhombotin-2; Rhombotin2; T cell translocation gene 2; T cell translocation protein 2; T-cell translocation protein 2; TTG 2; TTG2
Target Background
LMO2 encodes a cysteine-rich, two LIM-domain protein that is required for yolk sac erythropoiesis. The LMO2 protein has a central and crucial role in hematopoietic development and is highly conserved. The LMO2 transcription start site is located approximately 25 kb downstream from the 11p13 T-cell translocation cluster (11p13 ttc), where a number T-cell acute lymphoblastic leukemia-specific translocations occur. Alternative splicing results in multiple transcript variants encoding different isoforms.
Notification