Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CXCL1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 25-96 of mouse CXCL1(NP_032202.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CXCL1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 25-96 of mouse CXCL1(NP_032202.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
Western blot analysis of recombinant mouse CXCL1/GRO-alpha Protein using CXCL1 Rabbit mAb at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 5ng/1ng per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 90s.
| Cat.No | ADA-15640A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CXCL1 |
| Target Synonyms | KC; Fsp; N51; gro; Gro1; Mgsa; Scyb1; CXCL1 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Recombinant mouse CXCL1/GRO-alpha Protein | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 25-96 of mouse CXCL1(NP_032202.1). | Target Species | Mouse |
|---|---|---|---|
| Immunogen Sequence | APIANELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK | Uniprot ID | P12850 |
Uniprot Id
P12850
Target Species
Mouse
Target Name
CXCL1
Target Full Name
Growth-regulated alpha protein
Target Function
Has chemotactic activity for neutrophils. Contributes to neutrophil activation during inflammation. Hematoregulatory chemokine, which, in vitro, suppresses hematopoietic progenitor cell proliferation. KC(5-72) shows a highly enhanced hematopoietic activity.
Target Subcellular Location
Secreted.
Target Protein Families
Intercrine alpha (chemokine CxC) family
Target Synonyms
KC; Fsp; N51; gro; Gro1; Mgsa; Scyb1; CXCL1
Target Background
This gene encodes a protein that is a member of the CXC subfamily of chemokines. Chemokines, which recruit and activate leukocytes, are classified by function (inflammatory or homeostatic) or by structure. This secretory protein is proposed to bind the G-protein coupled receptor chemokine (C-X-C motif) receptor 2 to recruit neutrophils. In mouse, deficiency of this gene is associated with colitis and with defects in immune cell recruitment to the lung.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
