Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ELMOD2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of mouse ELMOD2 (Q8BGF6) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ELMOD2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of mouse ELMOD2 (Q8BGF6) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01909A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ELMOD2 |
| Target Synonyms | 9830169G11Rik; ELMOD2 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | LO2, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of mouse ELMOD2 (Q8BGF6). | Target Species | Mouse |
|---|---|---|---|
| Immunogen Sequence | MFVSLWEFFYGHFFRFWMKWLLRQMTGKCELQRIFDTYGGAQRTYRIENSLTYSKNKVLQNATRVAQSELDRCIANIMKEKNICSEKDTSFQICMRTCLLQITGYKQLYHDVENVRKKPYDSANAQHEKM | Uniprot ID | Q8IZ81 |
Uniprot Id
Q8IZ81
Target Species
Human
Target Name
ELMOD2
Target Full Name
ELMO domain-containing protein 2
Target Function
Acts as a GTPase-activating protein (GAP) toward guanine nucleotide exchange factors like ARL2, ARL3, ARF1 and ARF6, but not for GTPases outside the Arf family. Regulates IFN-related antiviral responses.
Target Tissue Specificity
Alveolar cells (morphologically type II cells) and alveolar macrophages (at protein level). Expressed in brain, colon, heart, kidney, liver, lung, muscle, placenta, small intestine, spleen, stomach and testis. In lung it is expressed in alveolar macrophag
Target Synonyms
9830169G11Rik; ELMD2_HUMAN; ELMO domain containing 2; ELMO domain containing protein 2; ELMO domain-containing protein 2; ELMO/CED 12 domain containing 2; ELMOD2; MGC10084
Target Background
This gene encodes one of six engulfment and motility (ELMO) domain-containing proteins. This gene is thought to play a role in antiviral responses. Mutations in this gene may be involved in the cause of familial idiopathic pulmonary fibrosis.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
