Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Lipocalin-2/NGAL was raised in Rabbit using the recombinant funsion protein containing a sequence corresponding to amino acids 21-200 of mouse Lipocalin-2/NGAL (NP_032517.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against Lipocalin-2/NGAL was raised in Rabbit using the recombinant funsion protein containing a sequence corresponding to amino acids 21-200 of mouse Lipocalin-2/NGAL (NP_032517.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
Western blot analysis of various lysates, using Mouse Lipocalin-2/NGAL Rabbit pAb at 1:800 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 1s.
| Cat.No | ADA-08234A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Lipocalin-2/NGAL |
| Target Synonyms | 24p3; AW212229; NRL; Sip24; Lipocalin-2/NGAL | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse ovary, Mouse spleen, Mouse uterus, Rat uterus | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant funsion protein containing a sequence corresponding to amino acids 21-200 of mouse Lipocalin-2/NGAL (NP_032517.1). | Target Species | Mouse |
|---|---|---|---|
| Immunogen Sequence | QDSTQNLIPAPSLLTVPLQPDFRSDQFRGRWYVVGLAGNAVQKKTEGSFTMYSTIYELQENNSYNVTSILVRDQDQGCRYWIRTFVPSSRAGQFTLGNMHRYPQVQSYNVQVATTDYNQFAMVFFRKTSENKQYFKITLYGRTKELSPELKERFTRFAKSLGLKDDNIIFSVPTDQCIDN | Uniprot ID | P11672 |
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
