Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Ly-6G was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 27-105 of mouse Ly-6G (NP_001297367.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against Ly-6G was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 27-105 of mouse Ly-6G (NP_001297367.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
Western blot analysis of Mouse bone marrow, using Ly-6G Rabbit pAb at 1:400 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 180s.
| Cat.No | ADA-07629A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Ly-6G |
| Target Synonyms | Gr1; Gr-1; Ly-6G | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse bone marrow | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 27-105 of mouse Ly-6G (NP_001297367.1). | Target Species | Mouse |
|---|---|---|---|
| Immunogen Sequence | LECYNCIGVPPETSCNTTTCPFSDGFCVALEIEVIVDSHRSKVKSNLCLPICPTTLDNTEITGNAVNVKTYCCKEDLCN | Uniprot ID | P35461 |
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
