Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Mfsd2a was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 170-245 of mouse Mfsd2a (NP_083938.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Mfsd2a was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 170-245 of mouse Mfsd2a (NP_083938.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09957A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MFSD2A |
| Target Synonyms | NLS1; Mfsd2; 1700018O18Rik; Mfsd2a | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, HepG2, Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 170-245 of mouse Mfsd2a (NP_083938.2). | Target Species | Mouse |
|---|---|---|---|
| Immunogen Sequence | SALTMFISTEQSERDSATAYRMTVEVLGTVIGTAIQGQIVGQAKAPCLQDQNGSVVVSEVANRTQSTASLKDTQNA | Uniprot ID | Q9DA75 |
Uniprot Id
Q9DA75
Target Synonyms
NLS1; Mfsd2; 1700018O18Rik; Mfsd2a
Target Background
Enables fatty acid transmembrane transporter activity; lysophosphatidylcholine flippase activity; and lysophospholipid:sodium symporter activity. Involved in central nervous system development; lipid transport; and transcytosis. Acts upstream of or within several processes, including photoreceptor cell development; regulation of lipid metabolic process; and retina development in camera-type eye. Located in plasma membrane. Is integral component of plasma membrane. Is expressed in several structures, including alimentary system; central nervous system; genitourinary system; integumental system; and sensory organ. Human ortholog(s) of this gene implicated in primary autosomal recessive microcephaly 15. Orthologous to human MFSD2A (major facilitator superfamily domain containing 2A).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
