Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Mrpl55 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 33-127 of mouse Mrpl55 (NP_001289265.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Mrpl55 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 33-127 of mouse Mrpl55 (NP_001289265.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06581A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MRPL55 |
| Target Synonyms | L55mt; MRP-L55; 2810038N09Rik; Mrpl55 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | MCF7, Mouse testis, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 33-127 of mouse Mrpl55 (NP_001289265.1). | Target Species | Mouse |
|---|---|---|---|
| Immunogen Sequence | DCSRASLTRLRRQAYARLYPVLLVKQDGSTIHIRYREPRRMLAMPLDLDALSPEERRARFRKREAQLQQKREEEPEVVDSFDTERYKQFWTKTKK | Uniprot ID | Q9CZ83 |
Uniprot Id
Q9CZ83
Target Synonyms
L55mt; MRP-L55; 2810038N09Rik; Mrpl55
Target Background
Predicted to be a structural constituent of ribosome. Predicted to be involved in translation. Located in mitochondrion. Is expressed in several structures, including early conceptus; gonad; heart; liver; and metanephros. Orthologous to human MRPL55 (mitochondrial ribosomal protein L55).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
