-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MTCO2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 101-200 of mouse MTCO2 (NP_904331.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against MTCO2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 101-200 of mouse MTCO2 (NP_904331.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-08701A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MTCO2 |
| Target Synonyms | COX2; MTCO2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Mouse kidney, Mouse liver, Rat kidney, Rat liver | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 101-200 of mouse MTCO2 (NP_904331.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GHQWYWSYEYTDYEDLCFDSYMIPTNDLKPGELRLLEVDNRVVLPMELPIRMLISSEDVLHSWAVPSLGLKTDAIPGRLNQATVTSNRPGLFYGQCSEIC | Uniprot ID | P00403 |
Uniprot Id
P00403
Target Species
Human
Target Name
MT-CO2
Target Full Name
Cytochrome c oxidase subunit 2
Target Function
Component of the cytochrome c oxidase, the last enzyme in the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII) and cytochrome c oxidase (complex IV, CIV), that cooperate to transfer electrons derived from NADH and succinate to molecular oxygen, creating an electrochemical gradient over the inner membrane that drives transmembrane transport and the ATP synthase. Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Electrons originating from reduced cytochrome c in the intermembrane space (IMS) are transferred via the dinuclear copper A center (CU(A)) of subunit 2 and heme A of subunit 1 to the active site in subunit 1, a binuclear center (BNC) formed by heme A3 and copper B (CU(B)). The BNC reduces molecular oxygen to 2 water molecules using 4 electrons from cytochrome c in the IMS and 4 protons from the mitochondrial matrix.
Target Involvement
Mitochondrial complex IV deficiency (MT-C4D)
Target Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.
Target Protein Families
Cytochrome c oxidase subunit 2 family
Target Synonyms
MT-CO2; COII; COX2; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Target Background
Predicted to enable copper ion binding activity and oxidoreductase activity. Predicted to contribute to cytochrome-c oxidase activity. Predicted to be involved in ATP synthesis coupled electron transport; positive regulation of cellular biosynthetic process; and positive regulation of necrotic cell death. Located in mitochondrion. Is expressed in embryo; epiblast; heart; liver; and metanephros. Orthologous to several human genes including MTCO2P12 (MT-CO2 pseudogene 12).
Notification