-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TP53BP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 200-330 of TP53BP2 (NP_001026855.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TP53BP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 200-330 of TP53BP2 (NP_001026855.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07795A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TP53BP2 |
| Target Synonyms | BBP; 53BP2; ASPP2; P53BP2; PPP1R13A; TP53BP2 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A549, DU-145, K-562, OVCAR-3 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 200-330 of TP53BP2 (NP_001026855.2). | Immunogen Sequence | RALKGHVEQKRLSNGKLVEEIEQMNNLFQQKQRELVLAVSKVEELTRQLEMLKNGRIDSHHDNQSAVAELDRLYKELQLRNKLNQEQNAKLQQQRECLNKRNSEVAVMDKRVNELRDRLWKKKAALQQKEN |
|---|---|---|---|
| Uniprot ID | Q13625 |
Uniprot Id
Q13625
Target Species
Human
Target Name
TP53BP2
Target Full Name
Apoptosis-stimulating of p53 protein 2
Target Function
Regulator that plays a central role in regulation of apoptosis and cell growth via its interactions with proteins such as TP53. Regulates TP53 by enhancing the DNA binding and transactivation function of TP53 on the promoters of proapoptotic genes in vivo. Inhibits the ability of NAE1 to conjugate NEDD8 to CUL1, and thereby decreases NAE1 ability to induce apoptosis. Impedes cell cycle progression at G2/M. Its apoptosis-stimulating activity is inhibited by its interaction with DDX42.
Target Subcellular Location
Cytoplasm, perinuclear region. Nucleus. Note=Predominantly found in the perinuclear region. Some small fraction is nuclear. Sequester in the cytoplasm on overexpression of DDX42.
Target Protein Families
ASPP family
Target Tissue Specificity
Widely expressed. Expressed in spleen, thymus, prostate, testis, ovary, small intestine, colon and peripheral blood leukocyte. Reduced expression in breast carcinomas expressing a wild-type TP53 protein. Overexpressed in lung cancer cell lines.
Target Synonyms
53BP2; Apoptosis stimulating of p53 protein 2; Apoptosis stimulating protein of p53 2; Apoptosis-stimulating of p53 protein 2; ASPP2; ASPP2_HUMAN; BBP; Bcl2 binding protein; Bcl2-binding protein; NY REN 51 antigen ; p53 binding protein 2; p53-binding protein 2; p53BP2; PPP1R13A; Renal carcinoma antigen NY-REN-51; Tp53bp2; Tumor protein p53 binding protein 2; Tumor suppressor p53 binding protein 2; Tumor suppressor p53-binding protein 2
Target Background
This gene encodes a member of the ASPP (apoptosis-stimulating protein of p53) family of p53 interacting proteins. The protein contains four ankyrin repeats and an SH3 domain involved in protein-protein interactions. It is localized to the perinuclear region of the cytoplasm, and regulates apoptosis and cell growth through interactions with other regulatory molecules including members of the p53 family. Multiple transcript variants encoding different isoforms have been found for this gene.
Notification