Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Dopamine Transporter/SLC6A3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Dopamine Transporter/SLC6A3 (NP_001035.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against Dopamine Transporter/SLC6A3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Dopamine Transporter/SLC6A3 (NP_001035.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-11388A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Dopamine Transporter/SLC6A3 |
| Target Synonyms | DAT; DAT1; PKDYS; PKDYS1; Dopamine Transporter/SLC6A3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Dopamine Transporter/SLC6A3 (NP_001035.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSKSKCSVGLMSSVVAPAKEPNAVGPKEVELILVKEQNGVQLTSSTLTNPRQSPVEAQDRETWGKKIDFLLSVIGFAVDLANVWRFPYLCYKNGGGAFLV | Uniprot ID | Q01959 |
Uniprot Id
Q01959
Target Species
Human
Target Name
SLC6A3
Target Full Name
Sodium-dependent dopamine transporter
Target Function
Amine transporter. Terminates the action of dopamine by its high affinity sodium-dependent reuptake into presynaptic terminals. Regulator of light-dependent retinal hyaloid vessel regression, downstream of OPN5 signaling.
Target Involvement
Parkinsonism-dystonia infantile (PKDYS)
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell projection, neuron projection.
Target Protein Families
Sodium:neurotransmitter symporter (SNF) (TC 2.A.22) family, SLC6A3 subfamily
Target Tissue Specificity
Highly expressed in substantia nigra.
Target Synonyms
DAT; DAT1; PKDYS; PKDYS1; Dopamine Transporter/SLC6A3
Target Background
This gene encodes a dopamine transporter which is a member of the sodium- and chloride-dependent neurotransmitter transporter family. The 3' UTR of this gene contains a 40 bp tandem repeat, referred to as a variable number tandem repeat or VNTR, which can be present in 3 to 11 copies. Variation in the number of repeats is associated with idiopathic epilepsy, attention-deficit hyperactivity disorder, dependence on alcohol and cocaine, susceptibility to Parkinson disease and protection against nicotine dependence.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
