-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TIGAR was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human TIGAR (NP_065108.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against TIGAR was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human TIGAR (NP_065108.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-11542A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TIGAR |
| Target Synonyms | FR2BP; C12orf5; TIGAR | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, Mouse skeletal muscle, Rat skeletal muscle | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human TIGAR (NP_065108.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LSELRAMAKAAREECPVFTPPGGETLDQVKMRGIDFFEFLCQLILKEADQKEQFSQGSPSNCLETSLAEIFPLGKNHSSKVNSDSGIPGLAASVLVVSHGA | Uniprot ID | Q9NQ88 |
Uniprot Id
Q9NQ88
Target Species
Human
Target Name
TIGAR
Target Full Name
Fructose-2,6-bisphosphatase TIGAR
Target Function
Fructose-bisphosphatase hydrolyzing fructose-2,6-bisphosphate as well as fructose-1,6-bisphosphate. Acts as a negative regulator of glycolysis by lowering intracellular levels of fructose-2,6-bisphosphate in a p53/TP53-dependent manner, resulting in the pentose phosphate pathway (PPP) activation and NADPH production. Contributes to the generation of reduced glutathione to cause a decrease in intracellular reactive oxygen species (ROS) content, correlating with its ability to protect cells from oxidative or metabolic stress-induced cell death. Plays a role in promoting protection against cell death during hypoxia by decreasing mitochondria ROS levels in a HK2-dependent manner through a mechanism that is independent of its fructose-bisphosphatase activity. In response to cardiac damage stress, mediates p53-induced inhibition of myocyte mitophagy through ROS levels reduction and the subsequent inactivation of BNIP3. Reduced mitophagy results in an enhanced apoptotic myocyte cell death, and exacerbates cardiac damage. Plays a role in adult intestinal regeneration; contributes to the growth, proliferation and survival of intestinal crypts following tissue ablation. Plays a neuroprotective role against ischemic brain damage by enhancing PPP flux and preserving mitochondria functions. Protects glioma cells from hypoxia- and ROS-induced cell death by inhibiting glycolysis and activating mitochondrial energy metabolism and oxygen consumption in a TKTL1-dependent and p53/TP53-independent manner. Plays a role in cancer cell survival by promoting DNA repair through activating PPP flux in a CDK5-ATM-dependent signaling pathway during hypoxia and/or genome stress-induced DNA damage responses. Involved in intestinal tumor progression.
Target Subcellular Location
Cytoplasm. Nucleus. Mitochondrion.
Target Protein Families
Phosphoglycerate mutase family
Target Tissue Specificity
Expressed in the brain. Expressed in breast tumors. Expressed in glioblastomas.
Target Synonyms
6-bisphosphatase TIGAR; C12ORF5; chromosome 12 open reading frame 5; FR2BP; Fructose-2,6-bisphosphatase TIGAR; Fructose-2,6-bisphosphate 2-phosphatase; Probable fructose 2,6 bisphosphatase TIGAR; Probable fructose-2; tigar; TIGAR_HUMAN; TP53 induced glycolysis and apoptosis regulator; TP53 induced glycolysis regulatory phosphatase; TP53-induced glycolysis and apoptosis regulator; Transactivated by NS3TP2 protein
Target Background
This gene is regulated as part of the p53 tumor suppressor pathway and encodes a protein with sequence similarity to the bisphosphate domain of the glycolytic enzyme that degrades fructose-2, 6-bisphosphate. The protein functions by blocking glycolysis and directing the pathway into the pentose phosphate shunt. Expression of this protein also protects cells from DNA damaging reactive oxygen species and provides some protection from DNA damage-induced apoptosis. The 12p13.32 region that includes this gene is paralogous to the 11q13.3 region.
Notification