Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HMGA2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 55-109 of human HMGA2 (NP_003474.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against HMGA2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 55-109 of human HMGA2 (NP_003474.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-12340A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HMGA2 |
| Target Synonyms | BABL; LIPO; SRS5; HMGIC; HMGI-C; STQTL9; HMGA2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, HCT116, Mouse brain, Rat liver, Rat thymus | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 55-109 of human HMGA2 (NP_003474.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SKNKSPSKAAQKKAEATGEKRPRGRPRKWPQQVVQKKPAQEETEETSSQESAEED | Uniprot ID | P52926 |
Uniprot Id
P52926
Target Species
Human
Target Name
HMGA2
Target Full Name
High mobility group protein HMGI-C
Target Function
Functions as a transcriptional regulator. Functions in cell cycle regulation through CCNA2. Plays an important role in chromosome condensation during the meiotic G2/M transition of spermatocytes. Plays a role in postnatal myogenesis, is involved in satellite cell activation. Positively regulates IGF2 expression through PLAG1 and in a PLAG1-independent manner.
Target Involvement
A chromosomal aberration involving HMGA2 is associated with a subclass of benign mesenchymal tumors known as lipomas. Translocation t(3;12)(q27-q28;q13-q15) with LPP is shown in lipomas. HMGA2 is also fused with a number of other genes in lipomas.
Target Subcellular Location
Nucleus.
Target Protein Families
HMGA family
Target Synonyms
HMGA 2; BABL; High mobility group (nonhistone chromosomal) protein isoform I C; High mobility group (nonhistone chromosomal) protein isoform IC; High Mobility Group AT hook 2; High Mobility Group AT hook protein 2; High mobility group AT-hook protein 2; High mobility group protein HMGI C; High mobility group protein HMGI-C; High mobility group protein HMGIC; High mobility group protein I, isoform C; HMGA2; HMGA2_HUMAN; HMGI C; HMGIC; LIPO; Non histone chromosomal architectural protein HMGI C; Non histone chromosomal architectural protein HMGIC; Pygmy; STQTL9
Target Background
This gene encodes a protein that belongs to the non-histone chromosomal high mobility group (HMG) protein family. HMG proteins function as architectural factors and are essential components of the enhancesome. This protein contains structural DNA-binding domains and may act as a transcriptional regulating factor. Identification of the deletion, amplification, and rearrangement of this gene that are associated with myxoid liposarcoma suggests a role in adipogenesis and mesenchymal differentiation. A gene knock out study of the mouse counterpart demonstrated that this gene is involved in diet-induced obesity. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
