-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against WNT1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 231-370 of human WNT1 (NP_005421.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against WNT1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 231-370 of human WNT1 (NP_005421.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-12426A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | WNT1 |
| Target Synonyms | INT1; OI15; BMND16; WNT1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Rat uterus | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 231-370 of human WNT1 (NP_005421.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TCWMRLPTLRAVGDVLRDRFDGASRVLYGNRGSNRASRAELLRLEPEDPAHKPPSPHDLVYFEKSPNFCTYSGRLGTAGTAGRACNSSSPALDGCELLCCGRGHRTRTQRVTERCNCTFHWCCHVSCRNCTHTRVLHECL | Uniprot ID | P04628 |
Uniprot Id
P04628
Target Species
Human
Target Name
WNT1
Target Full Name
Proto-oncogene Wnt-1
Target Function
Ligand for members of the frizzled family of seven transmembrane receptors. Acts in the canonical Wnt signaling pathway by promoting beta-catenin-dependent transcriptional activation. In some developmental processes, is also a ligand for the coreceptor RYK, thus triggering Wnt signaling. Plays an essential role in the development of the embryonic brain and central nervous system (CNS). Has a role in osteoblast function, bone development and bone homeostasis.
Target Involvement
Osteoporosis (OSTEOP); Osteogenesis imperfecta 15 (OI15); Osteogenesis imperfecta 14 (OI14)
Target Subcellular Location
Secreted, extracellular space, extracellular matrix. Secreted.
Target Protein Families
Wnt family
Target Research Area
Cancer
Target Synonyms
BMND16; INT1; OI15; oncogene Int1; Proto oncogene protein Wnt 1; Proto-oncogene Int-1 homolog; Proto-oncogene Wnt-1; Wingless type MMTV integration site family member 1; wingless-type MMTV integration site family; member 1 (oncogene INT1); Wnt 1; wnt1; WNT1_HUMAN
Target Background
The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family. It is very conserved in evolution, and the protein encoded by this gene is known to be 98% identical to the mouse Wnt1 protein at the amino acid level. The studies in mouse indicate that the Wnt1 protein functions in the induction of the mesencephalon and cerebellum. This gene was originally considered as a candidate gene for Joubert syndrome, an autosomal recessive disorder with cerebellar hypoplasia as a leading feature. However, further studies suggested that the gene mutations might not have a significant role in Joubert syndrome. This gene is clustered with another family member, WNT10B, in the chromosome 12q13 region.
Notification