-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TXNIP was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-166 of human TXNIP (NP_006463.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against TXNIP was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-166 of human TXNIP (NP_006463.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-12860A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TXNIP |
| Target Synonyms | THIF; VDUP1; ARRDC6; HHCPA78; EST01027; TXNIP | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse thymus | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-166 of human TXNIP (NP_006463.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MVMFKKIKSFEVVFNDPEKVYGSGEKVAGRVIVEVCEVTRVKAVRILACGVAKVLWMQGSQQCKQTSEYLRYEDTLLLEDQPTGENEMVIMRPGNKYEYKFGFELPQGPLGTSFKGKYGCVDYWVKAFLDRPSQPTQETKKNFEVVDLVDVNTPDLMAPVSAKKEK | Uniprot ID | Q9H3M7 |
Uniprot Id
Q9H3M7
Target Species
Human
Target Name
TXNIP
Target Full Name
Thioredoxin-interacting protein
Target Function
May act as an oxidative stress mediator by inhibiting thioredoxin activity or by limiting its bioavailability. Interacts with COPS5 and restores COPS5-induced suppression of CDKN1B stability, blocking the COPS5-mediated translocation of CDKN1B from the nucleus to the cytoplasm. Functions as a transcriptional repressor, possibly by acting as a bridge molecule between transcription factors and corepressor complexes, and over-expression will induce G0/G1 cell cycle arrest. Required for the maturation of natural killer cells. Acts as a suppressor of tumor cell growth. Inhibits the proteasomal degradation of DDIT4, and thereby contributes to the inhibition of the mammalian target of rapamycin complex 1 (mTORC1).
Target Subcellular Location
Cytoplasm.
Target Protein Families
Arrestin family
Target Research Area
Others
Target Synonyms
TXNIP; VDUP1; Thioredoxin-interacting protein; Thioredoxin-binding protein 2; Vitamin D3 up-regulated protein 1
Target Background
This gene encodes a thioredoxin-binding protein that is a member of the alpha arrestin protein family. Thioredoxin is a thiol-oxidoreductase that is a major regulator of cellular redox signaling which protects cells from oxidative stress. This protein inhibits the antioxidative function of thioredoxin resulting in the accumulation of reactive oxygen species and cellular stress. This protein also functions as a regulator of cellular metabolism and of endoplasmic reticulum (ER) stress. This protein may also function as a tumor suppressor. Alternate splicing results in multiple transcript variants.
Notification