-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against KMT1B / SUV39H2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 311-410 of human KMT1B / SUV39H2 (Q9H5I1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against KMT1B / SUV39H2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 311-410 of human KMT1B / SUV39H2 (Q9H5I1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13242A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | KMT1B / SUV39H2 |
| Target Synonyms | KMT1B; KMT1B / SUV39H2 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, PC-3 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 311-410 of human KMT1B / SUV39H2 (Q9H5I1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ESDEFTVDAARYGNVSHFVNHSCDPNLQVFNVFIDNLDTRLPRIALFSTRTINAGEELTFDYQMKGSGDISSDSIDHSPAKKRVRTVCKCGAVTCRGYLN | Uniprot ID | Q9H5I1 |
Uniprot Id
Q9H5I1
Target Species
Human
Target Name
SUV39H2
Target Full Name
Histone-lysine N-methyltransferase SUV39H2
Target Function
Histone methyltransferase that specifically trimethylates 'Lys-9' of histone H3 using monomethylated H3 'Lys-9' as substrate. H3 'Lys-9' trimethylation represents a specific tag for epigenetic transcriptional repression by recruiting HP1 (CBX1, CBX3 and/or CBX5) proteins to methylated histones. Mainly functions in heterochromatin regions, thereby playing a central role in the establishment of constitutive heterochromatin at pericentric and telomere regions. H3 'Lys-9' trimethylation is also required to direct DNA methylation at pericentric repeats. SUV39H1 is targeted to histone H3 via its interaction with RB1 and is involved in many processes, such as cell cycle regulation, transcriptional repression and regulation of telomere length. May participate in regulation of higher-order chromatin organization during spermatogenesis. Recruited by the large PER complex to the E-box elements of the circadian target genes such as PER2 itself or PER1, contributes to the conversion of local chromatin to a heterochromatin-like repressive state through H3 'Lys-9' trimethylation.
Target Subcellular Location
Nucleus. Chromosome, centromere.
Target Protein Families
Class V-like SAM-binding methyltransferase superfamily, Histone-lysine methyltransferase family, Suvar3-9 subfamily
Target Synonyms
FLJ23414; H3 K9 HMTase 2; H3-K9-HMTase 2; Histone H3 K9 methyltransferase 2; Histone H3-K9 methyltransferase 2; Histone lysine N methyltransferase H3 lysine 9 specific 2; Histone lysine N methyltransferase SUV39H2; Histone-lysine N-methyltransferase SUV39H2; KMT1B; Lysine N methyltransferase 1B ; Lysine N-methyltransferase 1B; sSuppressor of variegation 3 9 homolog 2 (Drosophila); Su(var)3 9 Drosophila homolog of 2; Su(var)3 9 homolog 2; Su(var)3-9 homolog 2; Suppressor of variegation 3 9 homolog 2; Suppressor of variegation 3-9 homolog 2; Suv39h2; SUV92_HUMAN
Target Background
Enables S-adenosyl-L-methionine binding activity; histone methyltransferase activity (H3-K9 specific); and zinc ion binding activity. Involved in chromatin assembly or disassembly and chromatin remodeling. Acts upstream of or within cellular response to hypoxia and negative regulation of transcription by RNA polymerase II. Located in chromatin.
Notification