-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NDUFA13/GRIM19 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 52-144 of human NDUFA13/GRIM19 (NP_057049.5) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NDUFA13/GRIM19 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 52-144 of human NDUFA13/GRIM19 (NP_057049.5) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13578A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NDUFA13/GRIM19 |
| Target Synonyms | B16.6; CDA016; CGI-39; GRIM19; GRIM-19; MC1DN28; 19 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 52-144 of human NDUFA13/GRIM19 (NP_057049.5). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KWNRERRRLQIEDFEARIALLPLLQAETDRRTLQMLRENLEEEAIIMKDVPDWKVGESVFHTTRWVPPLIGELYGLRTTEEALHASHGFMWYT | Uniprot ID | Q9P0J0 |
Uniprot Id
Q9P0J0
Target Species
Human
Target Name
NDUFA13
Target Full Name
NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13
Target Function
Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. Involved in the interferon/all-trans-retinoic acid (IFN/RA) induced cell death. This apoptotic activity is inhibited by interaction with viral IRF1. Prevents the transactivation of STAT3 target genes. May play a role in CARD15-mediated innate mucosal responses and serve to regulate intestinal epithelial cell responses to microbes.
Target Involvement
Hurthle cell thyroid carcinoma (HCTC)
Target Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein; Matrix side. Nucleus.
Target Protein Families
Complex I NDUFA13 subunit family
Target Tissue Specificity
Widely expressed, with highest expression in heart, skeletal muscle, liver, kidney and placenta. In intestinal mucosa, down-regulated in areas involved in Crohn disease and ulcerative colitis.
Target Synonyms
NDUFA13; GRIM19; CDA016; CGI-39; NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13; Cell death regulatory protein GRIM-19; Complex I-B16.6; CI-B16.6; Gene associated with retinoic and interferon-induced mortality 19 protein; GRIM-19; Gene associated with retinoic and IFN-induced mortality 19 protein; NADH-ubiquinone oxidoreductase B16.6 subunit
Target Background
This gene encodes a subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), which functions in the transfer of electrons from NADH to the respiratory chain. The protein is required for complex I assembly and electron transfer activity. The protein binds the signal transducers and activators of transcription 3 (STAT3) transcription factor, and can function as a tumor suppressor. The human protein purified from mitochondria migrates at approximately 16 kDa. Transcripts originating from an upstream promoter and capable of expressing a protein with a longer N-terminus have been found, but their biological validity has not been determined.
Notification