-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HP1 gamma/CBX3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human HP1 gamma/CBX3 (NP_057671.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against HP1 gamma/CBX3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human HP1 gamma/CBX3 (NP_057671.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-14098A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HP1 gamma/CBX3 |
| Target Synonyms | HECH; HP1-GAMMA; HP1Hs-gamma; HP1 gamma/CBX3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, Mouse spleen, Mouse thymus, SH-SY5Y | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HP1 gamma/CBX3 (NP_057671.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MASNKTTLQKMGKKQNGKSKKVEEAEPEEFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEAFLNSQKAGKEKDGTKRKSLSDSESD | Uniprot ID | Q13185 |
Uniprot Id
Q13185
Target Species
Human
Target Name
CBX3
Target Full Name
Chromobox protein homolog 3
Target Function
Seems to be involved in transcriptional silencing in heterochromatin-like complexes. Recognizes and binds histone H3 tails methylated at 'Lys-9', leading to epigenetic repression. May contribute to the association of the heterochromatin with the inner nuclear membrane through its interaction with lamin B receptor (LBR). Involved in the formation of functional kinetochore through interaction with MIS12 complex proteins. Contributes to the conversion of local chromatin to a heterochromatin-like repressive state through H3 'Lys-9' trimethylation, mediates the recruitment of the methyltransferases SUV39H1 and/or SUV39H2 by the PER complex to the E-box elements of the circadian target genes such as PER2 itself or PER1. Mediates the recruitment of NIPBL to sites of DNA damage at double-strand breaks (DSBs).
Target Subcellular Location
Nucleus.
Target Synonyms
CBX 3; CBX3; CBX3_HUMAN; Chromobox homolog 3 (HP1 gamma homolog; Drosophila); Chromobox homolog 3; Chromobox protein homolog 3; GAMMA; HECH; Heterochromatin like protein 1; Heterochromatin protein 1 homolog gamma; Heterochromatin protein HP1 gamma; HP1 gamma; HP1 gamma homolog; HP1Hs gamma; Modifier 2 protein
Target Background
At the nuclear envelope, the nuclear lamina and heterochromatin are adjacent to the inner nuclear membrane. The protein encoded by this gene binds DNA and is a component of heterochromatin. This protein also can bind lamin B receptor, an integral membrane protein found in the inner nuclear membrane. The dual binding functions of the encoded protein may explain the association of heterochromatin with the inner nuclear membrane. This protein binds histone H3 tails methylated at Lys-9 sites. This protein is also recruited to sites of ultraviolet-induced DNA damage and double-strand breaks. Two transcript variants encoding the same protein but differing in the 5' UTR, have been found for this gene.
Notification