-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TIMM50 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human TIMM50 (Q3ZCQ8) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against TIMM50 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human TIMM50 (Q3ZCQ8) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-14125A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TIMM50 |
| Target Synonyms | MGCA9; TIM50; TIM50L; TIMM50 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, HepG2, Mouse brain, Mouse liver | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TIMM50 (Q3ZCQ8). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAASAAVFSRLRSGLRLGSRGLCTRLATPPRRAPDQAAEIGSRGSTKAQGPQQQPGSEGPSYAKKVALWLAGLLGAGGTVSVVYIFGNNPVDENGAKIPD | Uniprot ID | Q3ZCQ8 |
Uniprot Id
Q3ZCQ8
Target Species
Human
Target Name
TIMM50
Target Full Name
Mitochondrial import inner membrane translocase subunit TIM50
Target Function
Essential component of the TIM23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane. Has some phosphatase activity in vitro; however such activity may not be relevant in vivo.; May participate in the release of snRNPs and SMN from the Cajal body.
Target Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.; [Isoform 2]: Nucleus speckle.
Target Protein Families
TIM50 family
Target Tissue Specificity
Widely expressed. Expressed at higher level in brain, kidney and liver (at protein level).
Target Synonyms
TIMM50; TIM50; PRO1512; Mitochondrial import inner membrane translocase subunit TIM50
Target Background
This gene encodes a subunit of the TIM23 inner mitochondrial membrane translocase complex. The encoded protein functions as the receptor subunit that recognizes the mitochondrial targeting signal, or presequence, on protein cargo that is destined for the mitochondrial inner membrane and matrix. This protein may also play a role in maintaining the membrane permeability barrier, and knockdown of this gene in human cells results in the release of cytochrome c and apoptosis.
Notification