Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HSPA12A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human HSPA12A (O43301) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against HSPA12A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human HSPA12A (O43301) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14290A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HSPA12A |
| Target Synonyms | HSPA12A ; HSPA12A | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Rat kidney | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human HSPA12A (O43301). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SEQQSFLVVVAVDFGTTSSGYAYSFTKEPECIHVMRRWEGGDPGVSNQKTPTTILLTPERKFHSFGYAARDFYHDLDPNEAKQWLYLEKFKMKLHTTGDLT | Uniprot ID | O43301 |
Uniprot Id
O43301
Target Species
Human
Target Name
HSPA12A
Target Full Name
Heat shock 70 kDa protein 12A
Target Function
Adapter protein for SORL1, but not SORT1. Delays SORL1 internalization and affects SORL1 subcellular localization.
Target Subcellular Location
Cytoplasm. Nucleus.
Target Protein Families
Heat shock protein 70 family
Target Tissue Specificity
Widely expressed with highest levels in brain, kidney and muscle.
Target Synonyms
FLJ13874; Heat shock 70 kDa protein 12A; heat shock 70kD protein 12A; heat shock 70kDa protein 12A; HS12A_HUMAN; Hspa12a; KIAA0417
Target Background
Predicted to enable ATP binding activity. Located in extracellular exosome.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
