-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Kinesin light chain 1 (KLC1) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 450-550 of human Kinesin light chain 1 (KLC1) (Q07866) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Kinesin light chain 1 (KLC1) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 450-550 of human Kinesin light chain 1 (KLC1) (Q07866) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14369A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Kinesin light chain 1 (KLC1) |
| Target Synonyms | KLC; KNS2; KNS2A; Kinesin light chain 1 (KLC1) | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, 293T, MCF7, Mouse brain, U-87MG | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 450-550 of human Kinesin light chain 1 (KLC1) (Q07866). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GGWYKACKVDSPTVTTTLKNLGALYRRQGKFEAAETLEEAAMRSRKQGLDNVHKQRVAEVLNDPENMEKRRSRESLNVDVVKYESGPDGGEEVSMSVEWNG | Uniprot ID | Q07866 |
Uniprot Id
Q07866
Target Species
Human
Target Name
KLC1
Target Full Name
Kinesin light chain 1
Target Function
Kinesin is a microtubule-associated force-producing protein that may play a role in organelle transport. The light chain may function in coupling of cargo to the heavy chain or in the modulation of its ATPase activity.
Target Subcellular Location
Cell projection, growth cone. Cytoplasmic vesicle. Cytoplasm, cytoskeleton.
Target Protein Families
Kinesin light chain family
Target Tissue Specificity
Found in a variety of tissues. Mostly abundant in brain and spine.
Target Synonyms
KLC; KNS2; KNS2A; Kinesin light chain 1 (KLC1)
Target Background
Conventional kinesin is a tetrameric molecule composed of two heavy chains and two light chains, and transports various cargos along microtubules toward their plus ends. The heavy chains provide the motor activity, while the light chains bind to various cargos. This gene encodes a member of the kinesin light chain family. It associates with kinesin heavy chain through an N-terminal domain, and six tetratricopeptide repeat (TPR) motifs are thought to be involved in binding of cargos such as vesicles, mitochondria, and the Golgi complex. Thus, kinesin light chains function as adapter molecules and not motors per se. Although previously named "kinesin 2", this gene is not a member of the kinesin-2 / kinesin heavy chain subfamily of kinesin motor proteins. Extensive alternative splicing produces isoforms with different C-termini that are proposed to bind to different cargos; however, the full-length nature and/or biological validity of most of these variants have not been determined.
Notification