-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RAB9A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human RAB9A (NP_004242.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against RAB9A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human RAB9A (NP_004242.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-16087A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RAB9A |
| Target Synonyms | RAB9; RAB9A | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, NIH/3T3, Hep G2, Mouse liver, Mouse lung, PC-12, Rat liver | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human RAB9A (NP_004242.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAGKSSLFKVILLGDGGVGKSSLMNRYVTNKFDTQLFHTIGVEFLNKDLEVDGHFVTMQIWDTAGQERFRSLRTPFYRGSDCCLLTFSVDDSQSFQNLSN | Uniprot ID | P51151 |
Uniprot Id
P51151
Target Species
Human
Target Name
RAB9A
Target Full Name
Ras-related protein Rab-9A
Target Function
Involved in the transport of proteins between the endosomes and the trans Golgi network. Involved in the recruitment of SGSM2 to melanosomes and is required for the proper trafficking of melanogenic enzymes TYR, TYRP1 and DCT/TYRP2 to melanosomes in melanocytes.
Target Subcellular Location
Cell membrane; Lipid-anchor; Cytoplasmic side. Endoplasmic reticulum membrane. Golgi apparatus membrane. Late endosome. Cytoplasmic vesicle, phagosome membrane; Lipid-anchor; Cytoplasmic side. Cytoplasmic vesicle, phagosome. Cytoplasmic vesicle membrane. Melanosome.
Target Protein Families
Small GTPase superfamily, Rab family
Target Synonyms
2410064E05Rik; AI195561; DmRab9; Rab 9; RAB 9A; RAB9 member RAS oncogene family; RAB9A; RAB9A member RAS oncogene family; RAB9A_HUMAN; RAS ASSOCIATED PROTEIN RAB9; Ras related protein Rab 9A; Ras-related protein Rab-9A; Sid6061p; Sid99
Target Background
Enables GDP binding activity; GTP binding activity; and GTPase activity. Involved in negative regulation by host of symbiont catalytic activity; positive regulation of exocytosis; and regulation of protein localization. Located in late endosome; lysosome; and phagocytic vesicle.
Notification