-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CPT2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 559-658 of human CPT2 (P23786) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CPT2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 559-658 of human CPT2 (P23786) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-16553A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CPT2 |
| Target Synonyms | CPT1; IIAE4; CPTASE; CPT2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse heart, Rat heart, 293T, HepG2, Mouse liver, Rat liver | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 559-658 of human CPT2 (P23786). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LRHLAAAKGIILPELYLDPAYGQINHNVLSTSTLSSPAVNLGGFAPVVSDGFGVGYAVHDNWIGCNVSSYPGRNAREFLQCVEKALEDMFDALEGKSIKS | Uniprot ID | P23786 |
Uniprot Id
P23786
Target Species
Human
Target Name
CPT2
Target Full Name
Carnitine O-palmitoyltransferase 2, mitochondrial
Target Function
Involved in the intramitochondrial synthesis of acylcarnitines from accumulated acyl-CoA metabolites. Reconverts acylcarnitines back into the respective acyl-CoA esters that can then undergo beta-oxidation, an essential step for the mitochondrial uptake of long-chain fatty acids and their subsequent beta-oxidation in the mitochondrion. Active with medium (C8-C12) and long-chain (C14-C18) acyl-CoA esters.
Target Involvement
Carnitine palmitoyltransferase 2 deficiency, myopathic, stress-induced (CPT2D); Carnitine palmitoyltransferase 2 deficiency, infantile (CPT2DI); Carnitine palmitoyltransferase 2 deficiency, lethal neonatal (CPT2DLN); Encephalopathy, acute, infection-induced, 4 (IIAE4)
Target Subcellular Location
Mitochondrion inner membrane; Peripheral membrane protein; Matrix side.
Target Protein Families
Carnitine/choline acetyltransferase family
Target Research Area
Cancer
Target Synonyms
Carnitine O palmitoyltransferase 2; Carnitine O palmitoyltransferase 2 mitochondrial; Carnitine O-palmitoyltransferase 2; Carnitine palmitoyltransferase 2; Carnitine palmitoyltransferase II; CPT 1; CPT 2; CPT II; CPT1; CPT2; CPT2_HUMAN; CPTASE; CPTII; IIAE4; mitochondrial
Target Background
The protein encoded by this gene is a nuclear protein which is transported to the mitochondrial inner membrane. Together with carnitine palmitoyltransferase I, the encoded protein oxidizes long-chain fatty acids in the mitochondria. Defects in this gene are associated with mitochondrial long-chain fatty-acid (LCFA) oxidation disorders.
Notification